Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J5WH64

Protein Details
Accession A0A1J5WH64   
Localization Confidence High
Confidence Score 17.8
NoLS Segment(s)
PositionSequenceProtein Nature
36-72IPAVRCLAPRRRRHDWKPRRKLQRRKSKQTKLLDARSBasic
112-136KQAITEMRVRKRRDPKTRFFSGRREBasic
NLS Segment(s)
PositionSequence
44-66PRRRRHDWKPRRKLQRRKSKQTK
121-129RKRRDPKTR
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 3
Family & Domain DBs
Amino Acid Sequences MTWFKLGKKGVKEETRTCEVPVTKDTTAAEMPKGSIPAVRCLAPRRRRHDWKPRRKLQRRKSKQTKLLDARSQRKACRRLAVSSSTPSWGTSEQESLAETPEAEVNLVKELKQAITEMRVRKRRDPKTRFFSGRRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.67
3 0.61
4 0.54
5 0.51
6 0.44
7 0.41
8 0.37
9 0.36
10 0.29
11 0.3
12 0.3
13 0.26
14 0.27
15 0.24
16 0.22
17 0.16
18 0.17
19 0.16
20 0.16
21 0.13
22 0.14
23 0.14
24 0.18
25 0.19
26 0.19
27 0.2
28 0.27
29 0.36
30 0.43
31 0.5
32 0.53
33 0.62
34 0.7
35 0.77
36 0.82
37 0.84
38 0.86
39 0.88
40 0.9
41 0.91
42 0.92
43 0.93
44 0.92
45 0.92
46 0.91
47 0.91
48 0.93
49 0.91
50 0.9
51 0.86
52 0.86
53 0.82
54 0.78
55 0.73
56 0.7
57 0.67
58 0.67
59 0.63
60 0.57
61 0.58
62 0.57
63 0.54
64 0.54
65 0.5
66 0.46
67 0.46
68 0.47
69 0.41
70 0.38
71 0.35
72 0.29
73 0.26
74 0.22
75 0.2
76 0.16
77 0.15
78 0.13
79 0.14
80 0.13
81 0.13
82 0.13
83 0.12
84 0.12
85 0.1
86 0.09
87 0.08
88 0.09
89 0.08
90 0.08
91 0.08
92 0.07
93 0.11
94 0.11
95 0.11
96 0.11
97 0.13
98 0.13
99 0.13
100 0.14
101 0.12
102 0.18
103 0.25
104 0.31
105 0.39
106 0.47
107 0.52
108 0.6
109 0.69
110 0.74
111 0.79
112 0.81
113 0.82
114 0.82
115 0.87
116 0.87