Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J5WFF7

Protein Details
Accession A0A1J5WFF7    Localization Confidence High Confidence Score 18.1
NoLS Segment(s)
PositionSequenceProtein Nature
14-33SEECKKHTPHKVSQSKKGKEBasic
53-93QKKPILRRKAKTTKKIQLKLECTACKKKQTRTLARCKHFELHydrophilic
NLS Segment(s)
PositionSequence
24-67KVSQSKKGKERLMAQGKRRYDRKQSGYGGQKKPILRRKAKTTKK
Subcellular Location(s) nucl 21, mito 3, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVSHPKTRNVYCPSEECKKHTPHKVSQSKKGKERLMAQGKRRYDRKQSGYGGQKKPILRRKAKTTKKIQLKLECTACKKKQTRTLARCKHFELSAEKKKKGGVLKY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.58
3 0.55
4 0.57
5 0.59
6 0.63
7 0.66
8 0.67
9 0.66
10 0.74
11 0.78
12 0.77
13 0.79
14 0.81
15 0.79
16 0.8
17 0.79
18 0.72
19 0.67
20 0.67
21 0.67
22 0.67
23 0.65
24 0.65
25 0.65
26 0.66
27 0.66
28 0.66
29 0.61
30 0.6
31 0.63
32 0.61
33 0.61
34 0.59
35 0.6
36 0.64
37 0.67
38 0.6
39 0.55
40 0.53
41 0.48
42 0.53
43 0.54
44 0.54
45 0.53
46 0.55
47 0.62
48 0.69
49 0.75
50 0.77
51 0.78
52 0.79
53 0.81
54 0.82
55 0.8
56 0.78
57 0.73
58 0.7
59 0.68
60 0.64
61 0.6
62 0.62
63 0.58
64 0.59
65 0.61
66 0.63
67 0.65
68 0.7
69 0.75
70 0.76
71 0.83
72 0.83
73 0.83
74 0.8
75 0.75
76 0.69
77 0.59
78 0.53
79 0.51
80 0.51
81 0.55
82 0.58
83 0.56
84 0.53
85 0.54
86 0.55