Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J5X1F8

Protein Details
Accession A0A1J5X1F8    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
144-163VSLPRNVPRQNRPLQRQKLLHydrophilic
NLS Segment(s)
PositionSequence
34-52RGRKRLPISNATKKPIREK
Subcellular Location(s) nucl 13, mito 7, cyto 6
Family & Domain DBs
Amino Acid Sequences ARDPVWDMEAGSIRELERRCKYVATKHQCLSGPRGRKRLPISNATKKPIREKREIGMQLFERGCEVENTELRAQWRKITKEVRAECRREMRLRWDVWRGTVADDFRRGRLTGGVEDDKSRAYGRSAMQGEPAGDARSNRPRLGVSLPRNVPRQNRPLQRQKLLGGQASQSEAARSRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.24
3 0.28
4 0.3
5 0.33
6 0.34
7 0.38
8 0.43
9 0.48
10 0.57
11 0.58
12 0.6
13 0.58
14 0.63
15 0.61
16 0.59
17 0.57
18 0.55
19 0.56
20 0.55
21 0.62
22 0.59
23 0.63
24 0.67
25 0.68
26 0.65
27 0.65
28 0.67
29 0.69
30 0.72
31 0.7
32 0.67
33 0.61
34 0.66
35 0.65
36 0.62
37 0.59
38 0.57
39 0.56
40 0.62
41 0.62
42 0.53
43 0.49
44 0.44
45 0.41
46 0.37
47 0.32
48 0.22
49 0.19
50 0.18
51 0.13
52 0.13
53 0.11
54 0.12
55 0.16
56 0.16
57 0.17
58 0.18
59 0.24
60 0.23
61 0.24
62 0.29
63 0.28
64 0.34
65 0.39
66 0.42
67 0.46
68 0.51
69 0.56
70 0.57
71 0.58
72 0.55
73 0.56
74 0.55
75 0.48
76 0.44
77 0.42
78 0.41
79 0.4
80 0.39
81 0.38
82 0.35
83 0.33
84 0.33
85 0.26
86 0.21
87 0.22
88 0.19
89 0.16
90 0.21
91 0.21
92 0.2
93 0.21
94 0.19
95 0.17
96 0.19
97 0.19
98 0.15
99 0.19
100 0.21
101 0.19
102 0.2
103 0.2
104 0.18
105 0.16
106 0.15
107 0.11
108 0.1
109 0.15
110 0.15
111 0.23
112 0.24
113 0.24
114 0.25
115 0.25
116 0.24
117 0.21
118 0.21
119 0.13
120 0.12
121 0.13
122 0.18
123 0.26
124 0.29
125 0.28
126 0.29
127 0.28
128 0.31
129 0.37
130 0.41
131 0.38
132 0.44
133 0.48
134 0.52
135 0.56
136 0.58
137 0.58
138 0.57
139 0.61
140 0.61
141 0.66
142 0.71
143 0.77
144 0.81
145 0.8
146 0.76
147 0.7
148 0.68
149 0.63
150 0.58
151 0.49
152 0.42
153 0.37
154 0.34
155 0.32
156 0.24
157 0.22