Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J5WJ78

Protein Details
Accession A0A1J5WJ78    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
94-121EYSEKLKRPPKELKKRKRTEPPQCMPAVHydrophilic
NLS Segment(s)
PositionSequence
84-111RYRKTHAVIREYSEKLKRPPKELKKRKR
Subcellular Location(s) mito 21, cyto 3, nucl 2, cyto_pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR004260  Pyr-dimer_DNA_glycosylase  
Pfam View protein in Pfam  
PF03013  Pyr_excise  
Amino Acid Sequences MNIFFLDRCPQKAARMHIDKHVVKMIVEAAQMLSMTHSVLSGAVVGYKATHRNHPMTRWAGTSTGNYKWVYGYMASLGREYRRRYRKTHAVIREYSEKLKRPPKELKKRKRTEPPQCMPAVYRQQDVVAAYRAYYKKEKLVLVSKKESDRSKRYTEKIRMGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.55
3 0.54
4 0.57
5 0.65
6 0.59
7 0.56
8 0.53
9 0.43
10 0.35
11 0.34
12 0.29
13 0.21
14 0.19
15 0.16
16 0.11
17 0.1
18 0.1
19 0.09
20 0.08
21 0.06
22 0.06
23 0.05
24 0.05
25 0.05
26 0.05
27 0.05
28 0.04
29 0.04
30 0.05
31 0.05
32 0.05
33 0.05
34 0.07
35 0.13
36 0.14
37 0.2
38 0.25
39 0.31
40 0.35
41 0.37
42 0.42
43 0.4
44 0.4
45 0.36
46 0.33
47 0.28
48 0.26
49 0.26
50 0.22
51 0.19
52 0.21
53 0.2
54 0.18
55 0.17
56 0.16
57 0.14
58 0.11
59 0.09
60 0.08
61 0.1
62 0.1
63 0.1
64 0.1
65 0.12
66 0.17
67 0.2
68 0.28
69 0.35
70 0.39
71 0.44
72 0.52
73 0.59
74 0.63
75 0.68
76 0.67
77 0.64
78 0.61
79 0.61
80 0.58
81 0.5
82 0.46
83 0.42
84 0.37
85 0.38
86 0.45
87 0.44
88 0.45
89 0.54
90 0.61
91 0.68
92 0.75
93 0.79
94 0.82
95 0.87
96 0.9
97 0.9
98 0.9
99 0.9
100 0.9
101 0.86
102 0.81
103 0.74
104 0.66
105 0.56
106 0.53
107 0.51
108 0.43
109 0.37
110 0.3
111 0.29
112 0.3
113 0.3
114 0.24
115 0.18
116 0.15
117 0.14
118 0.21
119 0.22
120 0.25
121 0.29
122 0.29
123 0.32
124 0.37
125 0.39
126 0.38
127 0.47
128 0.52
129 0.54
130 0.59
131 0.59
132 0.59
133 0.64
134 0.66
135 0.65
136 0.65
137 0.64
138 0.67
139 0.7
140 0.73
141 0.77
142 0.78