Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J5WXK1

Protein Details
Accession A0A1J5WXK1   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
53-75FLEAGRRYKEKKKKENNRFLVAMHydrophilic
NLS Segment(s)
PositionSequence
59-66RYKEKKKK
Subcellular Location(s) cyto 14, cyto_nucl 12.5, nucl 7, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR042855  V_SNARE_CC  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF00957  Synaptobrevin  
Amino Acid Sequences MEAAGDSVLVCDEHTKDVGSIIQKDLVQAEERERELSRLDDAVVEADGATHNFLEAGRRYKEKKKKENNRFLVAMAVVVCIFVVAVLGLFFVDILI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.11
4 0.12
5 0.16
6 0.17
7 0.18
8 0.17
9 0.19
10 0.19
11 0.19
12 0.19
13 0.17
14 0.15
15 0.14
16 0.17
17 0.17
18 0.18
19 0.19
20 0.19
21 0.18
22 0.18
23 0.18
24 0.15
25 0.12
26 0.12
27 0.1
28 0.09
29 0.09
30 0.07
31 0.06
32 0.04
33 0.04
34 0.04
35 0.04
36 0.04
37 0.03
38 0.03
39 0.03
40 0.04
41 0.06
42 0.09
43 0.13
44 0.16
45 0.2
46 0.25
47 0.35
48 0.45
49 0.53
50 0.61
51 0.68
52 0.77
53 0.84
54 0.91
55 0.89
56 0.86
57 0.76
58 0.66
59 0.57
60 0.46
61 0.35
62 0.24
63 0.17
64 0.1
65 0.08
66 0.07
67 0.05
68 0.04
69 0.03
70 0.03
71 0.02
72 0.03
73 0.03
74 0.03
75 0.03
76 0.03