Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J5WQ89

Protein Details
Accession A0A1J5WQ89    Localization Confidence High Confidence Score 16.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MTKKRRNGGRSKNGRGHVKPBasic
78-105AVHSKIVRVRSKKDRKKREIPRDALQDMHydrophilic
NLS Segment(s)
PositionSequence
3-16KKRRNGGRSKNGRG
85-97RVRSKKDRKKREI
Subcellular Location(s) nucl 16, cyto_nucl 10.5, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
Amino Acid Sequences MTKKRRNGGRSKNGRGHVKPVRCSNCARCVPKDKAIKQITVKNLVDAAAHIDYTNACVFDQYALPKHYNKQYYCVSCAVHSKIVRVRSKKDRKKREIPRDALQDMRRENHGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.77
3 0.75
4 0.74
5 0.71
6 0.68
7 0.7
8 0.68
9 0.61
10 0.65
11 0.62
12 0.62
13 0.63
14 0.61
15 0.58
16 0.6
17 0.63
18 0.65
19 0.68
20 0.61
21 0.62
22 0.6
23 0.59
24 0.55
25 0.56
26 0.52
27 0.5
28 0.47
29 0.37
30 0.35
31 0.29
32 0.24
33 0.18
34 0.16
35 0.08
36 0.08
37 0.07
38 0.07
39 0.07
40 0.09
41 0.09
42 0.06
43 0.06
44 0.06
45 0.06
46 0.07
47 0.08
48 0.08
49 0.11
50 0.13
51 0.15
52 0.16
53 0.21
54 0.26
55 0.32
56 0.32
57 0.34
58 0.39
59 0.41
60 0.42
61 0.41
62 0.35
63 0.3
64 0.34
65 0.31
66 0.3
67 0.28
68 0.29
69 0.31
70 0.39
71 0.45
72 0.45
73 0.5
74 0.55
75 0.67
76 0.73
77 0.79
78 0.82
79 0.84
80 0.9
81 0.93
82 0.93
83 0.92
84 0.89
85 0.87
86 0.85
87 0.78
88 0.76
89 0.68
90 0.64
91 0.58
92 0.54