Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J5WMZ9

Protein Details
Accession A0A1J5WMZ9    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
42-65LPDGVKKIQVKKDKKRKNTITVVIHydrophilic
NLS Segment(s)
PositionSequence
52-57KKDKKR
Subcellular Location(s) cyto_mito 11.666, mito 11.5, cyto 10.5, cyto_nucl 8.333, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036603  RBP11-like  
IPR009025  RBP11-like_dimer  
IPR008193  RNA_pol_Rpb11_13-16kDa_CS  
Gene Ontology GO:0055029  C:nuclear DNA-directed RNA polymerase complex  
GO:0003677  F:DNA binding  
GO:0003899  F:DNA-directed 5'-3' RNA polymerase activity  
GO:0046983  F:protein dimerization activity  
GO:0006351  P:DNA-templated transcription  
Pfam View protein in Pfam  
PF13656  RNA_pol_L_2  
PROSITE View protein in PROSITE  
PS01154  RNA_POL_L_13KD  
Amino Acid Sequences MFQTPLLDTVSPVSVLRSSAGAFLSASPLPMNLDERFESFVLPDGVKKIQVKKDKKRKNTITVVIEREDHTVGNVLCAALQAHPDVEFAAYTAPHPLIPRVEVTVTTDGTTSPESAVSAAFESIIGKSVLVENAFSEALHRAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.13
4 0.11
5 0.11
6 0.12
7 0.12
8 0.11
9 0.1
10 0.1
11 0.12
12 0.11
13 0.11
14 0.1
15 0.1
16 0.1
17 0.11
18 0.14
19 0.12
20 0.15
21 0.15
22 0.17
23 0.19
24 0.18
25 0.16
26 0.13
27 0.16
28 0.14
29 0.13
30 0.13
31 0.13
32 0.13
33 0.17
34 0.2
35 0.23
36 0.3
37 0.39
38 0.49
39 0.57
40 0.67
41 0.74
42 0.8
43 0.84
44 0.85
45 0.84
46 0.83
47 0.79
48 0.76
49 0.71
50 0.64
51 0.54
52 0.47
53 0.38
54 0.31
55 0.24
56 0.16
57 0.11
58 0.11
59 0.1
60 0.09
61 0.08
62 0.06
63 0.06
64 0.06
65 0.06
66 0.04
67 0.05
68 0.05
69 0.05
70 0.05
71 0.06
72 0.06
73 0.05
74 0.05
75 0.04
76 0.05
77 0.05
78 0.05
79 0.06
80 0.06
81 0.07
82 0.08
83 0.1
84 0.1
85 0.11
86 0.12
87 0.13
88 0.13
89 0.12
90 0.16
91 0.17
92 0.16
93 0.15
94 0.14
95 0.13
96 0.14
97 0.15
98 0.11
99 0.09
100 0.09
101 0.09
102 0.09
103 0.09
104 0.08
105 0.08
106 0.07
107 0.07
108 0.06
109 0.07
110 0.07
111 0.08
112 0.08
113 0.07
114 0.07
115 0.09
116 0.12
117 0.11
118 0.12
119 0.1
120 0.13
121 0.13
122 0.12
123 0.12