Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J5WME7

Protein Details
Accession A0A1J5WME7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
83-107QTCPTCRVVVCRRRRRKDKTYLVFLHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 10.5, cyto_nucl 6, E.R. 5, extr 4, plas 3, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001841  Znf_RING  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF13639  zf-RING_2  
PROSITE View protein in PROSITE  
PS50089  ZF_RING_2  
Amino Acid Sequences MEEARFFFILAAEACVLFVWALVWARRKQGREGLLQYRESRECPEEACPVCLGGLLGGGKIVTLLCLHTFHRDCIVPWLRESQTCPTCRVVVCRRRRRKDKTYLVFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.09
4 0.06
5 0.06
6 0.04
7 0.05
8 0.07
9 0.1
10 0.16
11 0.17
12 0.25
13 0.3
14 0.32
15 0.35
16 0.4
17 0.42
18 0.44
19 0.48
20 0.49
21 0.49
22 0.49
23 0.46
24 0.43
25 0.4
26 0.34
27 0.31
28 0.25
29 0.21
30 0.2
31 0.21
32 0.23
33 0.22
34 0.22
35 0.19
36 0.17
37 0.16
38 0.15
39 0.11
40 0.05
41 0.05
42 0.04
43 0.04
44 0.04
45 0.04
46 0.03
47 0.04
48 0.03
49 0.03
50 0.03
51 0.04
52 0.05
53 0.07
54 0.08
55 0.15
56 0.16
57 0.16
58 0.2
59 0.2
60 0.19
61 0.28
62 0.33
63 0.28
64 0.28
65 0.33
66 0.31
67 0.33
68 0.36
69 0.35
70 0.36
71 0.37
72 0.38
73 0.35
74 0.38
75 0.37
76 0.43
77 0.44
78 0.46
79 0.56
80 0.64
81 0.72
82 0.8
83 0.89
84 0.9
85 0.9
86 0.92
87 0.92