Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J5WJH2

Protein Details
Accession A0A1J5WJH2    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
2-34GKAQRVAKEKQAHRKQNCLVRERRTRGTNRKKLHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 9.5, mito 9, cyto_nucl 7, pero 4, nucl 3.5
Family & Domain DBs
Amino Acid Sequences MGKAQRVAKEKQAHRKQNCLVRERRTRGTNRKKLETGIQEQKETRGEAVVETEKVFIVFGAAERRGVFFLFFVGIFARSDREDQFFWWCVFGEQHRPRASVFVVEESLACV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.81
3 0.79
4 0.77
5 0.76
6 0.74
7 0.71
8 0.7
9 0.75
10 0.72
11 0.72
12 0.72
13 0.74
14 0.77
15 0.8
16 0.8
17 0.77
18 0.77
19 0.71
20 0.66
21 0.64
22 0.6
23 0.56
24 0.57
25 0.52
26 0.47
27 0.45
28 0.45
29 0.39
30 0.32
31 0.24
32 0.15
33 0.13
34 0.11
35 0.13
36 0.12
37 0.11
38 0.1
39 0.1
40 0.09
41 0.09
42 0.08
43 0.05
44 0.04
45 0.04
46 0.04
47 0.07
48 0.07
49 0.08
50 0.08
51 0.09
52 0.09
53 0.1
54 0.09
55 0.06
56 0.06
57 0.06
58 0.06
59 0.06
60 0.06
61 0.07
62 0.07
63 0.07
64 0.08
65 0.09
66 0.11
67 0.13
68 0.16
69 0.16
70 0.17
71 0.22
72 0.23
73 0.22
74 0.21
75 0.19
76 0.17
77 0.2
78 0.22
79 0.27
80 0.31
81 0.39
82 0.41
83 0.42
84 0.41
85 0.42
86 0.4
87 0.35
88 0.31
89 0.27
90 0.24
91 0.24