Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J5WT31

Protein Details
Accession A0A1J5WT31   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MEIVQRRKKKKLETMACFIDFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15.5, cyto_mito 13, cyto 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR043502  DNA/RNA_pol_sf  
IPR043128  Rev_trsase/Diguanyl_cyclase  
IPR000477  RT_dom  
Pfam View protein in Pfam  
PF00078  RVT_1  
PROSITE View protein in PROSITE  
PS50878  RT_POL  
CDD cd01650  RT_nLTR_like  
Amino Acid Sequences MEIVQRRKKKKLETMACFIDFEKAFDKVPQRAMIRKAAAKIGLTEDDRLLRFLRGIYSGAKTRLRGDTDENAWELSQGVRQGCPLSPTLFNLFVDDALDAIKERGVSVPEMDGKVAGLCYADDIVLLAETREKLQEAANGLSSWASIWGMRINTQKCGVIHFGEGEIAEIKLQGETLPNPESYVYLGMDLDASLSRQRMVKRRLDKGIGCVEAMKKFLRNPSIPLLHKSLALKNVLIPTLTFGAEITGSTLAATKKAQGVANRAAEMMLGAGIAAAAVRRDLGTPPIKTIAACLQRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.8
3 0.73
4 0.64
5 0.54
6 0.49
7 0.39
8 0.33
9 0.27
10 0.22
11 0.22
12 0.26
13 0.31
14 0.29
15 0.34
16 0.38
17 0.4
18 0.45
19 0.48
20 0.51
21 0.51
22 0.5
23 0.48
24 0.45
25 0.43
26 0.37
27 0.34
28 0.3
29 0.29
30 0.26
31 0.25
32 0.23
33 0.24
34 0.24
35 0.24
36 0.21
37 0.17
38 0.16
39 0.16
40 0.16
41 0.14
42 0.15
43 0.17
44 0.2
45 0.23
46 0.27
47 0.29
48 0.29
49 0.31
50 0.35
51 0.35
52 0.34
53 0.35
54 0.36
55 0.36
56 0.37
57 0.33
58 0.28
59 0.25
60 0.22
61 0.17
62 0.12
63 0.11
64 0.11
65 0.12
66 0.11
67 0.12
68 0.14
69 0.14
70 0.16
71 0.15
72 0.15
73 0.15
74 0.17
75 0.2
76 0.2
77 0.19
78 0.19
79 0.17
80 0.14
81 0.14
82 0.11
83 0.08
84 0.06
85 0.06
86 0.05
87 0.05
88 0.05
89 0.05
90 0.05
91 0.07
92 0.08
93 0.08
94 0.09
95 0.1
96 0.12
97 0.12
98 0.12
99 0.1
100 0.09
101 0.09
102 0.08
103 0.06
104 0.04
105 0.03
106 0.04
107 0.04
108 0.04
109 0.04
110 0.04
111 0.04
112 0.04
113 0.04
114 0.03
115 0.04
116 0.05
117 0.05
118 0.06
119 0.06
120 0.07
121 0.08
122 0.1
123 0.11
124 0.12
125 0.12
126 0.12
127 0.11
128 0.1
129 0.09
130 0.07
131 0.05
132 0.04
133 0.03
134 0.04
135 0.06
136 0.07
137 0.1
138 0.16
139 0.16
140 0.18
141 0.19
142 0.21
143 0.19
144 0.21
145 0.2
146 0.15
147 0.15
148 0.13
149 0.12
150 0.1
151 0.1
152 0.08
153 0.06
154 0.05
155 0.05
156 0.05
157 0.05
158 0.04
159 0.04
160 0.04
161 0.05
162 0.06
163 0.09
164 0.1
165 0.1
166 0.11
167 0.11
168 0.11
169 0.1
170 0.11
171 0.08
172 0.07
173 0.07
174 0.07
175 0.06
176 0.06
177 0.06
178 0.04
179 0.05
180 0.06
181 0.06
182 0.08
183 0.11
184 0.16
185 0.25
186 0.31
187 0.39
188 0.47
189 0.54
190 0.59
191 0.62
192 0.59
193 0.55
194 0.55
195 0.47
196 0.39
197 0.34
198 0.31
199 0.26
200 0.27
201 0.22
202 0.18
203 0.19
204 0.25
205 0.3
206 0.29
207 0.31
208 0.37
209 0.44
210 0.44
211 0.45
212 0.45
213 0.38
214 0.4
215 0.38
216 0.35
217 0.31
218 0.3
219 0.27
220 0.24
221 0.26
222 0.23
223 0.21
224 0.17
225 0.15
226 0.15
227 0.15
228 0.12
229 0.09
230 0.1
231 0.1
232 0.09
233 0.08
234 0.07
235 0.07
236 0.07
237 0.1
238 0.09
239 0.11
240 0.12
241 0.13
242 0.16
243 0.2
244 0.23
245 0.25
246 0.31
247 0.37
248 0.4
249 0.38
250 0.35
251 0.31
252 0.27
253 0.23
254 0.16
255 0.08
256 0.04
257 0.03
258 0.03
259 0.03
260 0.03
261 0.03
262 0.03
263 0.03
264 0.04
265 0.05
266 0.05
267 0.07
268 0.09
269 0.17
270 0.24
271 0.25
272 0.29
273 0.32
274 0.32
275 0.31
276 0.33
277 0.35