Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J5WH35

Protein Details
Accession A0A1J5WH35    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
130-152HGPVASQKEKKFPKKPKTKDSRQBasic
NLS Segment(s)
PositionSequence
134-151ASQKEKKFPKKPKTKDSR
Subcellular Location(s) mito 18.5, cyto_mito 11.5, cyto 3.5, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002478  PUA  
IPR015947  PUA-like_sf  
IPR036974  PUA_sf  
IPR004802  tRNA_PsdUridine_synth_B_fam  
IPR004521  Uncharacterised_CHP00451  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0003723  F:RNA binding  
GO:0006396  P:RNA processing  
Pfam View protein in Pfam  
PF01472  PUA  
PROSITE View protein in PROSITE  
PS50890  PUA  
CDD cd21148  PUA_Cbf5  
Amino Acid Sequences QAREPSSETASRSWAFFICLSRSAYRRACSRRVIKPLEWFLDGFKKLIVKDSTVNALCYGAKLMLPGLLRYDQGIEVGEEVLMVSTKGEAVGIGIAQMTSPTIAACDHGLVCKLKRVIMDKDTYPRKWGHGPVASQKEKKFPKKPKTKDSRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.21
3 0.21
4 0.23
5 0.21
6 0.23
7 0.26
8 0.29
9 0.3
10 0.35
11 0.38
12 0.39
13 0.45
14 0.48
15 0.51
16 0.56
17 0.62
18 0.64
19 0.67
20 0.7
21 0.65
22 0.67
23 0.67
24 0.61
25 0.54
26 0.45
27 0.39
28 0.39
29 0.35
30 0.27
31 0.21
32 0.2
33 0.19
34 0.25
35 0.23
36 0.18
37 0.2
38 0.21
39 0.26
40 0.25
41 0.25
42 0.19
43 0.18
44 0.16
45 0.14
46 0.13
47 0.07
48 0.06
49 0.06
50 0.06
51 0.07
52 0.08
53 0.08
54 0.09
55 0.09
56 0.09
57 0.09
58 0.1
59 0.07
60 0.07
61 0.08
62 0.06
63 0.05
64 0.05
65 0.05
66 0.04
67 0.04
68 0.03
69 0.03
70 0.03
71 0.02
72 0.02
73 0.02
74 0.03
75 0.03
76 0.02
77 0.03
78 0.03
79 0.03
80 0.03
81 0.03
82 0.03
83 0.03
84 0.03
85 0.03
86 0.03
87 0.03
88 0.03
89 0.04
90 0.04
91 0.05
92 0.05
93 0.06
94 0.07
95 0.07
96 0.1
97 0.12
98 0.13
99 0.17
100 0.18
101 0.19
102 0.23
103 0.27
104 0.31
105 0.34
106 0.38
107 0.37
108 0.45
109 0.51
110 0.48
111 0.47
112 0.42
113 0.41
114 0.44
115 0.45
116 0.44
117 0.43
118 0.47
119 0.53
120 0.62
121 0.64
122 0.64
123 0.61
124 0.62
125 0.66
126 0.71
127 0.72
128 0.73
129 0.76
130 0.82
131 0.9
132 0.91