Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J5WJW3

Protein Details
Accession A0A1J5WJW3    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MPKETKKKQTKEKSKTEKKPRVSSAYNHydrophilic
NLS Segment(s)
PositionSequence
6-21KKKQTKEKSKTEKKPR
Subcellular Location(s) nucl 20.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
IPR006780  YABBY  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF04690  YABBY  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd00084  HMG-box_SF  
Amino Acid Sequences MPKETKKKQTKEKSKTEKKPRVSSAYNFYMKEELARVKAKTPEISHRDAFRKAAENWASATENPKNKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.93
3 0.94
4 0.92
5 0.9
6 0.89
7 0.85
8 0.81
9 0.75
10 0.69
11 0.65
12 0.63
13 0.58
14 0.48
15 0.42
16 0.35
17 0.3
18 0.26
19 0.21
20 0.14
21 0.14
22 0.16
23 0.16
24 0.18
25 0.22
26 0.24
27 0.26
28 0.28
29 0.34
30 0.36
31 0.41
32 0.4
33 0.43
34 0.45
35 0.43
36 0.42
37 0.36
38 0.36
39 0.32
40 0.39
41 0.35
42 0.32
43 0.31
44 0.33
45 0.32
46 0.27
47 0.32
48 0.31