Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J5WF59

Protein Details
Accession A0A1J5WF59   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-37MDRRPKFQRPSGKPQGRAPERHNPYSKTQDRRPRTGKBasic
NLS Segment(s)
PositionSequence
9-20RPSGKPQGRAPE
Subcellular Location(s) nucl 12, mito 8, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR000692  Fibrillarin  
IPR020813  Fibrillarin_CS  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0008168  F:methyltransferase activity  
GO:0003723  F:RNA binding  
GO:0032259  P:methylation  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF01269  Fibrillarin  
PROSITE View protein in PROSITE  
PS00566  FIBRILLARIN  
CDD cd02440  AdoMet_MTases  
Amino Acid Sequences MDRRPKFQRPSGKPQGRAPERHNPYSKTQDRRPRTGKVFIKAHSPGVFVAHGGKEDVLVTRSLYPGEAVYGEKRIKVDDKDGGDKIEYRVWNPFRSKIAAGILCGVENIHIGPGTRVLYLGAASGTTVSHVADVVGPEGIVYAVEFSARSGRDLVTMAKKRANVIPIVEDARYPQRYRMLVGSVDVIFSDVAQPDQVRIVGLNAQHFLKTGGHVLLSIKASCVDSTAEATTVFAQEVSRMRGEMIKPREQVLLDPYEKEHALVVGVYRDTGKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.82
3 0.79
4 0.78
5 0.74
6 0.73
7 0.72
8 0.75
9 0.74
10 0.67
11 0.67
12 0.7
13 0.72
14 0.7
15 0.72
16 0.73
17 0.74
18 0.8
19 0.78
20 0.77
21 0.75
22 0.76
23 0.74
24 0.72
25 0.71
26 0.62
27 0.64
28 0.56
29 0.55
30 0.46
31 0.4
32 0.31
33 0.27
34 0.26
35 0.18
36 0.19
37 0.14
38 0.14
39 0.13
40 0.12
41 0.1
42 0.1
43 0.11
44 0.09
45 0.09
46 0.1
47 0.11
48 0.11
49 0.11
50 0.11
51 0.1
52 0.09
53 0.09
54 0.09
55 0.09
56 0.1
57 0.16
58 0.16
59 0.17
60 0.17
61 0.19
62 0.22
63 0.23
64 0.27
65 0.27
66 0.31
67 0.35
68 0.35
69 0.33
70 0.3
71 0.29
72 0.26
73 0.26
74 0.22
75 0.18
76 0.26
77 0.27
78 0.33
79 0.34
80 0.36
81 0.33
82 0.36
83 0.35
84 0.29
85 0.31
86 0.26
87 0.23
88 0.21
89 0.18
90 0.15
91 0.14
92 0.12
93 0.07
94 0.06
95 0.06
96 0.04
97 0.04
98 0.04
99 0.05
100 0.07
101 0.08
102 0.07
103 0.07
104 0.07
105 0.07
106 0.07
107 0.07
108 0.05
109 0.04
110 0.04
111 0.04
112 0.03
113 0.04
114 0.04
115 0.03
116 0.04
117 0.04
118 0.04
119 0.04
120 0.04
121 0.04
122 0.04
123 0.04
124 0.04
125 0.04
126 0.03
127 0.03
128 0.02
129 0.02
130 0.02
131 0.03
132 0.03
133 0.03
134 0.07
135 0.07
136 0.08
137 0.08
138 0.09
139 0.1
140 0.11
141 0.13
142 0.19
143 0.23
144 0.25
145 0.27
146 0.27
147 0.28
148 0.3
149 0.29
150 0.21
151 0.19
152 0.19
153 0.18
154 0.19
155 0.17
156 0.14
157 0.15
158 0.2
159 0.21
160 0.2
161 0.21
162 0.25
163 0.26
164 0.28
165 0.28
166 0.24
167 0.21
168 0.21
169 0.21
170 0.15
171 0.14
172 0.12
173 0.1
174 0.07
175 0.07
176 0.08
177 0.05
178 0.06
179 0.07
180 0.07
181 0.07
182 0.08
183 0.08
184 0.07
185 0.07
186 0.08
187 0.1
188 0.11
189 0.12
190 0.13
191 0.14
192 0.13
193 0.14
194 0.15
195 0.13
196 0.12
197 0.13
198 0.12
199 0.11
200 0.12
201 0.13
202 0.15
203 0.16
204 0.14
205 0.13
206 0.13
207 0.14
208 0.13
209 0.14
210 0.11
211 0.1
212 0.13
213 0.13
214 0.12
215 0.11
216 0.12
217 0.12
218 0.11
219 0.1
220 0.08
221 0.08
222 0.11
223 0.14
224 0.17
225 0.16
226 0.16
227 0.17
228 0.22
229 0.25
230 0.31
231 0.35
232 0.39
233 0.4
234 0.42
235 0.45
236 0.4
237 0.4
238 0.36
239 0.37
240 0.3
241 0.31
242 0.3
243 0.31
244 0.3
245 0.28
246 0.23
247 0.15
248 0.14
249 0.13
250 0.13
251 0.13
252 0.13
253 0.13