Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J5WDW9

Protein Details
Accession A0A1J5WDW9    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
79-101AGKTRRTGKTRGKQTENKKHWVGBasic
NLS Segment(s)
PositionSequence
79-96AGKTRRTGKTRGKQTENK
Subcellular Location(s) nucl 14, mito 12
Family & Domain DBs
Amino Acid Sequences MSEAGARDTDTSGGALSERGLLQARRKTAQMCSQRCKKSADSETREITGDKTRNNSECRNRREANRRQECWRGEMTRGAGKTRRTGKTRGKQTENKKHWVGYSTQRKRWGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.07
4 0.08
5 0.08
6 0.09
7 0.12
8 0.14
9 0.21
10 0.26
11 0.3
12 0.3
13 0.32
14 0.33
15 0.36
16 0.42
17 0.45
18 0.48
19 0.53
20 0.6
21 0.63
22 0.64
23 0.63
24 0.56
25 0.56
26 0.57
27 0.59
28 0.56
29 0.56
30 0.55
31 0.52
32 0.49
33 0.4
34 0.32
35 0.29
36 0.25
37 0.21
38 0.23
39 0.25
40 0.29
41 0.33
42 0.38
43 0.41
44 0.47
45 0.51
46 0.55
47 0.55
48 0.59
49 0.65
50 0.68
51 0.69
52 0.7
53 0.67
54 0.65
55 0.7
56 0.64
57 0.58
58 0.54
59 0.45
60 0.37
61 0.38
62 0.35
63 0.32
64 0.31
65 0.31
66 0.29
67 0.3
68 0.36
69 0.41
70 0.45
71 0.45
72 0.53
73 0.6
74 0.66
75 0.74
76 0.76
77 0.76
78 0.78
79 0.85
80 0.87
81 0.83
82 0.81
83 0.74
84 0.67
85 0.61
86 0.56
87 0.5
88 0.5
89 0.54
90 0.56
91 0.59