Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J5X6P9

Protein Details
Accession A0A1J5X6P9    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
93-130NGLATNEKKGRKQRKEKKNKAKKLRGKKKADFLYGKKKBasic
NLS Segment(s)
PositionSequence
99-130EKKGRKQRKEKKNKAKKLRGKKKADFLYGKKK
Subcellular Location(s) cyto 12.5, cyto_nucl 10.5, nucl 7.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MGDFVIEIRSSMSNKLLDRKQVSFEVQHLGGKAATNEEIRSFLKKEYKTSAEAVIVYGVQTVFGGGRTTGFARVYDTPTAAKRIEEKYMLARNGLATNEKKGRKQRKEKKNKAKKLRGKKKADFLYGKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.31
3 0.34
4 0.39
5 0.43
6 0.44
7 0.44
8 0.44
9 0.44
10 0.38
11 0.36
12 0.32
13 0.28
14 0.27
15 0.23
16 0.21
17 0.18
18 0.16
19 0.15
20 0.11
21 0.12
22 0.12
23 0.12
24 0.12
25 0.14
26 0.15
27 0.17
28 0.17
29 0.19
30 0.26
31 0.27
32 0.3
33 0.33
34 0.35
35 0.35
36 0.35
37 0.33
38 0.26
39 0.25
40 0.21
41 0.15
42 0.12
43 0.09
44 0.07
45 0.05
46 0.04
47 0.04
48 0.04
49 0.03
50 0.04
51 0.04
52 0.03
53 0.04
54 0.05
55 0.06
56 0.07
57 0.08
58 0.08
59 0.1
60 0.12
61 0.15
62 0.14
63 0.15
64 0.15
65 0.16
66 0.19
67 0.16
68 0.16
69 0.17
70 0.19
71 0.22
72 0.21
73 0.21
74 0.25
75 0.31
76 0.3
77 0.26
78 0.24
79 0.23
80 0.23
81 0.23
82 0.21
83 0.16
84 0.23
85 0.3
86 0.33
87 0.39
88 0.48
89 0.58
90 0.64
91 0.73
92 0.78
93 0.81
94 0.9
95 0.94
96 0.95
97 0.95
98 0.95
99 0.95
100 0.96
101 0.95
102 0.95
103 0.95
104 0.94
105 0.93
106 0.91
107 0.91
108 0.88
109 0.87
110 0.85