Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J5WMB9

Protein Details
Accession A0A1J5WMB9    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
89-108EDIERKKREVAERRKKEAKKBasic
NLS Segment(s)
PositionSequence
73-81KKASKEAPR
91-108IERKKREVAERRKKEAKK
Subcellular Location(s) nucl 16, cyto_nucl 11.5, mito 5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038630  L24e/L24_sf  
IPR000988  Ribosomal_L24e-rel  
Gene Ontology GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF01246  Ribosomal_L24e  
Amino Acid Sequences MRVEICSFSGFKIHPGHGSILVQNDMKTIRLFSKRCHSYHTEKTKPHDHDWTVFARRKNKKGIVEETETKVIKKASKEAPRAVAGMSAEDIERKKREVAERRKKEAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.27
3 0.29
4 0.26
5 0.28
6 0.24
7 0.22
8 0.22
9 0.21
10 0.18
11 0.17
12 0.15
13 0.15
14 0.14
15 0.13
16 0.17
17 0.24
18 0.26
19 0.29
20 0.39
21 0.44
22 0.44
23 0.48
24 0.49
25 0.49
26 0.57
27 0.63
28 0.6
29 0.58
30 0.63
31 0.66
32 0.64
33 0.6
34 0.56
35 0.48
36 0.43
37 0.42
38 0.41
39 0.38
40 0.37
41 0.37
42 0.4
43 0.44
44 0.47
45 0.52
46 0.53
47 0.54
48 0.57
49 0.6
50 0.56
51 0.55
52 0.54
53 0.49
54 0.48
55 0.41
56 0.34
57 0.3
58 0.27
59 0.24
60 0.23
61 0.27
62 0.32
63 0.41
64 0.46
65 0.48
66 0.51
67 0.49
68 0.47
69 0.4
70 0.33
71 0.24
72 0.19
73 0.15
74 0.11
75 0.1
76 0.12
77 0.13
78 0.17
79 0.19
80 0.2
81 0.23
82 0.29
83 0.39
84 0.47
85 0.57
86 0.63
87 0.71
88 0.78