Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J5XD10

Protein Details
Accession A0A1J5XD10    Localization Confidence Low Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
88-114WSATLAKCSRSRRPCKRRVETATPFGWHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 9, cyto_mito 9
Family & Domain DBs
Amino Acid Sequences MEGRPAEGPYLLAARGTLVCSKWLHRWYKARRLDLQLRQPRHNNSNTGCPENGEKVQSRRPNRSAEKKTGGPRATSLISKSPRITTGWSATLAKCSRSRRPCKRRVETATPFGWPEVLAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.12
4 0.13
5 0.11
6 0.15
7 0.17
8 0.2
9 0.26
10 0.33
11 0.37
12 0.43
13 0.53
14 0.58
15 0.67
16 0.72
17 0.71
18 0.69
19 0.72
20 0.73
21 0.72
22 0.73
23 0.72
24 0.68
25 0.68
26 0.67
27 0.65
28 0.63
29 0.58
30 0.53
31 0.47
32 0.51
33 0.48
34 0.46
35 0.39
36 0.33
37 0.31
38 0.29
39 0.27
40 0.2
41 0.2
42 0.2
43 0.28
44 0.34
45 0.37
46 0.41
47 0.44
48 0.5
49 0.55
50 0.62
51 0.61
52 0.61
53 0.61
54 0.6
55 0.62
56 0.62
57 0.55
58 0.45
59 0.4
60 0.36
61 0.33
62 0.28
63 0.24
64 0.24
65 0.25
66 0.27
67 0.28
68 0.26
69 0.25
70 0.26
71 0.27
72 0.24
73 0.26
74 0.25
75 0.26
76 0.26
77 0.25
78 0.31
79 0.28
80 0.28
81 0.3
82 0.35
83 0.43
84 0.51
85 0.62
86 0.66
87 0.76
88 0.82
89 0.86
90 0.9
91 0.9
92 0.89
93 0.89
94 0.85
95 0.82
96 0.74
97 0.66
98 0.57
99 0.47
100 0.38