Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J5WD24

Protein Details
Accession A0A1J5WD24   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
157-177LISSRPPKNKERKISRMGIRNHydrophilic
NLS Segment(s)
PositionSequence
162-176PPKNKERKISRMGIR
Subcellular Location(s) cyto 13.5, cyto_nucl 9, cysk 5, nucl 3.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036691  Endo/exonu/phosph_ase_sf  
Amino Acid Sequences SAEDGAGKQGVGIAIHRSLEFSELGAISPYFCLCEIRGLFGRLTLGSVYIPCGAQTATMEILGMTISKLVARGGLLGGNWNMGRKELEKEAEKWLLDTKVVGTCGSEVTRHGYSPRREDWSALDFFLTVGPVNTTTAEVDRDLTISDNWPATLKAQLISSRPPKNKERKISRMGIRNKAEKLADHPLWTLSEVSVESMLENIKRIADEQNLWCRGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.15
3 0.15
4 0.14
5 0.14
6 0.15
7 0.14
8 0.11
9 0.12
10 0.11
11 0.11
12 0.12
13 0.11
14 0.1
15 0.1
16 0.1
17 0.08
18 0.08
19 0.1
20 0.09
21 0.17
22 0.17
23 0.21
24 0.24
25 0.25
26 0.25
27 0.24
28 0.25
29 0.17
30 0.17
31 0.12
32 0.1
33 0.08
34 0.09
35 0.1
36 0.09
37 0.09
38 0.08
39 0.09
40 0.08
41 0.08
42 0.08
43 0.09
44 0.08
45 0.08
46 0.08
47 0.07
48 0.07
49 0.06
50 0.06
51 0.04
52 0.03
53 0.03
54 0.04
55 0.04
56 0.04
57 0.05
58 0.05
59 0.05
60 0.05
61 0.06
62 0.06
63 0.07
64 0.07
65 0.08
66 0.08
67 0.09
68 0.09
69 0.09
70 0.1
71 0.1
72 0.13
73 0.15
74 0.19
75 0.2
76 0.22
77 0.26
78 0.28
79 0.26
80 0.24
81 0.24
82 0.2
83 0.17
84 0.15
85 0.12
86 0.11
87 0.11
88 0.1
89 0.08
90 0.08
91 0.09
92 0.09
93 0.08
94 0.07
95 0.1
96 0.11
97 0.11
98 0.13
99 0.19
100 0.22
101 0.27
102 0.3
103 0.31
104 0.31
105 0.32
106 0.33
107 0.3
108 0.28
109 0.23
110 0.2
111 0.14
112 0.14
113 0.13
114 0.1
115 0.05
116 0.04
117 0.05
118 0.05
119 0.06
120 0.06
121 0.06
122 0.07
123 0.07
124 0.08
125 0.08
126 0.09
127 0.08
128 0.08
129 0.08
130 0.09
131 0.09
132 0.09
133 0.1
134 0.09
135 0.09
136 0.1
137 0.1
138 0.1
139 0.12
140 0.11
141 0.11
142 0.13
143 0.16
144 0.17
145 0.24
146 0.32
147 0.38
148 0.43
149 0.48
150 0.55
151 0.64
152 0.71
153 0.75
154 0.77
155 0.77
156 0.8
157 0.83
158 0.81
159 0.8
160 0.78
161 0.77
162 0.74
163 0.71
164 0.65
165 0.6
166 0.54
167 0.46
168 0.44
169 0.43
170 0.38
171 0.33
172 0.32
173 0.29
174 0.29
175 0.28
176 0.23
177 0.13
178 0.13
179 0.12
180 0.12
181 0.11
182 0.1
183 0.09
184 0.09
185 0.11
186 0.1
187 0.11
188 0.11
189 0.11
190 0.12
191 0.14
192 0.17
193 0.21
194 0.26
195 0.32
196 0.41