Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J5X6J9

Protein Details
Accession A0A1J5X6J9   
Localization Confidence Medium
Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
70-90QKEVPKRIRIRVSRKRNPDEDBasic
NLS Segment(s)
PositionSequence
28-44GKGRKRRATRAIKAVRK
66-85WEKGQKEVPKRIRIRVSRKR
Subcellular Location(s) nucl 19.5, cyto_nucl 13.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000054  Ribosomal_L31e  
IPR020052  Ribosomal_L31e_CS  
IPR023621  Ribosomal_L31e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01198  Ribosomal_L31e  
PROSITE View protein in PROSITE  
PS01144  RIBOSOMAL_L31E  
CDD cd00463  Ribosomal_L31e  
Amino Acid Sequences MQEDREETMLLDTVTKDFTMRLGQKVVGKGRKRRATRAIKAVRKFVQREMKTTLVRIDTELNKKIWEKGQKEVPKRIRIRVSRKRNPDEDAQERLYSHVLWIPVASFKNLETETVED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.1
4 0.09
5 0.1
6 0.18
7 0.2
8 0.22
9 0.23
10 0.26
11 0.29
12 0.35
13 0.42
14 0.42
15 0.47
16 0.53
17 0.61
18 0.67
19 0.68
20 0.7
21 0.73
22 0.75
23 0.75
24 0.77
25 0.77
26 0.76
27 0.74
28 0.73
29 0.68
30 0.64
31 0.59
32 0.56
33 0.56
34 0.49
35 0.5
36 0.48
37 0.48
38 0.42
39 0.41
40 0.35
41 0.26
42 0.25
43 0.22
44 0.21
45 0.19
46 0.23
47 0.24
48 0.22
49 0.22
50 0.23
51 0.24
52 0.26
53 0.3
54 0.28
55 0.32
56 0.41
57 0.47
58 0.52
59 0.59
60 0.62
61 0.63
62 0.64
63 0.66
64 0.66
65 0.67
66 0.72
67 0.73
68 0.76
69 0.76
70 0.82
71 0.83
72 0.78
73 0.73
74 0.71
75 0.69
76 0.64
77 0.61
78 0.54
79 0.47
80 0.43
81 0.4
82 0.33
83 0.24
84 0.19
85 0.16
86 0.13
87 0.12
88 0.12
89 0.12
90 0.15
91 0.16
92 0.16
93 0.14
94 0.14
95 0.2
96 0.2
97 0.21