Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J5X3Q4

Protein Details
Accession A0A1J5X3Q4    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
2-29KQNAQVSSSRRKARKRHFTANSEQRRKMHydrophilic
NLS Segment(s)
PositionSequence
11-17RRKARKR
Subcellular Location(s) nucl 17.5, mito_nucl 13, mito 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR041988  KOW_RPL26/RPL24  
IPR014722  Rib_L2_dom2  
IPR005756  Ribosomal_L26/L24P_euk/arc  
IPR008991  Translation_prot_SH3-like_sf  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF16906  Ribosomal_L26  
CDD cd06089  KOW_RPL26  
Amino Acid Sequences MKQNAQVSSSRRKARKRHFTANSEQRRKMMSTQLSKDLRAKYNIRSIPIHKDDEVLIKKGSHKGTKGKVISVRRAKWVVYLDTVKKEKMDGTPVSVGLRPCNLEIVTLNGTERRIAAINRKTQSKTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.84
3 0.83
4 0.85
5 0.85
6 0.85
7 0.86
8 0.87
9 0.87
10 0.83
11 0.76
12 0.67
13 0.61
14 0.57
15 0.5
16 0.48
17 0.45
18 0.45
19 0.47
20 0.54
21 0.53
22 0.52
23 0.53
24 0.5
25 0.45
26 0.43
27 0.42
28 0.37
29 0.45
30 0.45
31 0.42
32 0.41
33 0.4
34 0.43
35 0.44
36 0.42
37 0.33
38 0.32
39 0.29
40 0.33
41 0.32
42 0.24
43 0.21
44 0.19
45 0.21
46 0.25
47 0.28
48 0.24
49 0.25
50 0.31
51 0.34
52 0.41
53 0.4
54 0.38
55 0.41
56 0.43
57 0.49
58 0.5
59 0.48
60 0.45
61 0.45
62 0.41
63 0.39
64 0.37
65 0.3
66 0.26
67 0.28
68 0.26
69 0.31
70 0.33
71 0.29
72 0.26
73 0.25
74 0.23
75 0.21
76 0.25
77 0.2
78 0.23
79 0.24
80 0.25
81 0.25
82 0.26
83 0.24
84 0.19
85 0.2
86 0.17
87 0.15
88 0.18
89 0.16
90 0.15
91 0.15
92 0.18
93 0.18
94 0.17
95 0.17
96 0.16
97 0.17
98 0.16
99 0.16
100 0.13
101 0.15
102 0.18
103 0.27
104 0.33
105 0.41
106 0.46
107 0.52