Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J5WZK0

Protein Details
Accession A0A1J5WZK0    Localization Confidence High Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MAKKKNFSAHNQKKKAHRNGIKKFKLAHydrophilic
48-71RVEKRRLCDEKTKRRFDRERILYGBasic
NLS Segment(s)
PositionSequence
9-24AHNQKKKAHRNGIKKF
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKKKNFSAHNQKKKAHRNGIKKFKLAYDRSHKWSETTLMEENMKIERVEKRRLCDEKTKRRFDRERILYGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.86
3 0.85
4 0.83
5 0.83
6 0.85
7 0.9
8 0.85
9 0.78
10 0.69
11 0.64
12 0.64
13 0.56
14 0.53
15 0.52
16 0.52
17 0.54
18 0.55
19 0.49
20 0.42
21 0.4
22 0.34
23 0.26
24 0.24
25 0.2
26 0.18
27 0.19
28 0.17
29 0.17
30 0.14
31 0.14
32 0.1
33 0.11
34 0.17
35 0.22
36 0.32
37 0.35
38 0.39
39 0.48
40 0.53
41 0.56
42 0.59
43 0.65
44 0.67
45 0.74
46 0.79
47 0.76
48 0.82
49 0.85
50 0.83
51 0.84
52 0.81