Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J5WS87

Protein Details
Accession A0A1J5WS87    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
17-37LKTGKHQPLRSKEQRKATVRRBasic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 11.833, cyto 10, cyto_mito 7.833
Family & Domain DBs
Amino Acid Sequences MPFAWTASALKELIVFLKTGKHQPLRSKEQRKATVRRANSFRLQETALLYFWKKEKSWRRVYLEEEAADKKAHLEEIHRRGHAGHIATRKAAAEEIYPVRDSEIEEVISECRVCDHKGKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.09
4 0.14
5 0.17
6 0.22
7 0.3
8 0.35
9 0.4
10 0.49
11 0.58
12 0.63
13 0.71
14 0.74
15 0.74
16 0.77
17 0.81
18 0.8
19 0.8
20 0.8
21 0.78
22 0.74
23 0.75
24 0.7
25 0.65
26 0.64
27 0.59
28 0.5
29 0.43
30 0.38
31 0.31
32 0.28
33 0.24
34 0.17
35 0.15
36 0.13
37 0.13
38 0.14
39 0.16
40 0.14
41 0.22
42 0.32
43 0.4
44 0.49
45 0.55
46 0.59
47 0.6
48 0.63
49 0.59
50 0.52
51 0.44
52 0.36
53 0.29
54 0.24
55 0.21
56 0.17
57 0.12
58 0.1
59 0.1
60 0.08
61 0.13
62 0.21
63 0.28
64 0.33
65 0.32
66 0.32
67 0.31
68 0.34
69 0.33
70 0.26
71 0.24
72 0.26
73 0.27
74 0.27
75 0.28
76 0.25
77 0.22
78 0.2
79 0.15
80 0.1
81 0.14
82 0.17
83 0.18
84 0.18
85 0.18
86 0.18
87 0.18
88 0.18
89 0.16
90 0.15
91 0.13
92 0.13
93 0.14
94 0.14
95 0.15
96 0.14
97 0.11
98 0.12
99 0.14
100 0.17