Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J5WEK2

Protein Details
Accession A0A1J5WEK2   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-24VHRARPRAKPPRHRRDRDTVSLSRBasic
NLS Segment(s)
PositionSequence
4-15ARPRAKPPRHRR
Subcellular Location(s) nucl 14, mito 9, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences VHRARPRAKPPRHRRDRDTVSLSRDKIQRINIQLTEKKIIVKGNLDVFRFLKKNITATEMDFFADKRKKALGSTEITLAVGEMESICFGRKGLSVLSRIT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.89
3 0.87
4 0.85
5 0.82
6 0.75
7 0.72
8 0.7
9 0.63
10 0.59
11 0.53
12 0.47
13 0.43
14 0.44
15 0.42
16 0.41
17 0.44
18 0.42
19 0.45
20 0.45
21 0.44
22 0.41
23 0.36
24 0.32
25 0.28
26 0.26
27 0.21
28 0.2
29 0.19
30 0.23
31 0.26
32 0.25
33 0.25
34 0.24
35 0.25
36 0.24
37 0.22
38 0.19
39 0.17
40 0.19
41 0.18
42 0.21
43 0.19
44 0.2
45 0.21
46 0.17
47 0.16
48 0.13
49 0.13
50 0.17
51 0.2
52 0.19
53 0.19
54 0.22
55 0.23
56 0.24
57 0.3
58 0.29
59 0.29
60 0.3
61 0.3
62 0.28
63 0.26
64 0.25
65 0.18
66 0.12
67 0.07
68 0.06
69 0.04
70 0.04
71 0.05
72 0.05
73 0.06
74 0.06
75 0.06
76 0.08
77 0.09
78 0.11
79 0.16
80 0.2