Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J5WWN9

Protein Details
Accession A0A1J5WWN9   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-52MDDRHVTERKKREKQKRDEHVHGIKQKTIEKLLKRPERKKTKEKEAAREEKKBasic
NLS Segment(s)
PositionSequence
9-55RKKREKQKRDEHVHGIKQKTIEKLLKRPERKKTKEKEAAREEKKHRY
Subcellular Location(s) nucl 25.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MDDRHVTERKKREKQKRDEHVHGIKQKTIEKLLKRPERKKTKEKEAAREEKKHRYKYVDSKKETYLLIKKTSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.92
3 0.92
4 0.91
5 0.88
6 0.87
7 0.84
8 0.82
9 0.78
10 0.69
11 0.6
12 0.54
13 0.5
14 0.44
15 0.41
16 0.39
17 0.36
18 0.41
19 0.49
20 0.54
21 0.6
22 0.64
23 0.69
24 0.73
25 0.77
26 0.8
27 0.78
28 0.8
29 0.81
30 0.81
31 0.8
32 0.8
33 0.82
34 0.79
35 0.79
36 0.74
37 0.75
38 0.77
39 0.74
40 0.69
41 0.66
42 0.69
43 0.71
44 0.76
45 0.76
46 0.73
47 0.7
48 0.68
49 0.64
50 0.57
51 0.54
52 0.51
53 0.46