Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J5XAX5

Protein Details
Accession A0A1J5XAX5    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MNIRKVLKAKKNKSKDIRPKQLLEQTHydrophilic
NLS Segment(s)
PositionSequence
5-20KVLKAKKNKSKDIRPK
Subcellular Location(s) mito 12, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR038661  L35A_sf  
IPR001780  Ribosomal_L35A  
IPR018266  Ribosomal_L35Ae_CS  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01247  Ribosomal_L35Ae  
PROSITE View protein in PROSITE  
PS01105  RIBOSOMAL_L35AE  
Amino Acid Sequences MNIRKVLKAKKNKSKDIRPKQLLEQTGPRLHANGRHLGYRRGRRIQHPAQSLLSIDDVHTKEDASFYVGKAVHYVYHGKKEVKGTTERAMKGTVTRVHGNSGAVMARFERPLPAESFGCVVRVMLYPSRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.91
3 0.92
4 0.92
5 0.88
6 0.83
7 0.81
8 0.78
9 0.71
10 0.65
11 0.61
12 0.56
13 0.53
14 0.5
15 0.42
16 0.36
17 0.34
18 0.34
19 0.3
20 0.31
21 0.29
22 0.32
23 0.33
24 0.39
25 0.47
26 0.5
27 0.54
28 0.55
29 0.57
30 0.58
31 0.66
32 0.67
33 0.66
34 0.61
35 0.56
36 0.49
37 0.46
38 0.4
39 0.31
40 0.23
41 0.15
42 0.11
43 0.13
44 0.12
45 0.13
46 0.12
47 0.11
48 0.11
49 0.11
50 0.11
51 0.08
52 0.08
53 0.07
54 0.12
55 0.12
56 0.12
57 0.12
58 0.12
59 0.1
60 0.11
61 0.17
62 0.14
63 0.2
64 0.24
65 0.24
66 0.27
67 0.31
68 0.33
69 0.31
70 0.34
71 0.32
72 0.35
73 0.41
74 0.39
75 0.35
76 0.33
77 0.3
78 0.28
79 0.3
80 0.27
81 0.25
82 0.28
83 0.27
84 0.29
85 0.3
86 0.28
87 0.22
88 0.19
89 0.16
90 0.13
91 0.12
92 0.11
93 0.12
94 0.12
95 0.13
96 0.14
97 0.14
98 0.17
99 0.2
100 0.22
101 0.21
102 0.21
103 0.23
104 0.21
105 0.19
106 0.16
107 0.14
108 0.12
109 0.13
110 0.16