Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J5WTF3

Protein Details
Accession A0A1J5WTF3   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
55-88VPKRDEKIAQREKKKKKMFQKTQKGQPRLRNQLQHydrophilic
NLS Segment(s)
PositionSequence
49-80DREAPAVPKRDEKIAQREKKKKKMFQKTQKGQ
Subcellular Location(s) nucl 18.5, cyto_nucl 11, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013730  Fyv7/TAP26  
Pfam View protein in Pfam  
PF08524  rRNA_processing  
Amino Acid Sequences MFLSQGFLQRTPLWMGRIRNAHIEKMERLRRNAYRSEGLEMEEREGKGDREAPAVPKRDEKIAQREKKKKKMFQKTQKGQPRLRNQLQNVLKKIPKNGPCSDGNKKDNRTIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.32
3 0.36
4 0.41
5 0.41
6 0.45
7 0.44
8 0.44
9 0.42
10 0.43
11 0.41
12 0.45
13 0.52
14 0.47
15 0.48
16 0.52
17 0.54
18 0.55
19 0.55
20 0.51
21 0.48
22 0.45
23 0.45
24 0.37
25 0.33
26 0.32
27 0.27
28 0.24
29 0.21
30 0.19
31 0.16
32 0.17
33 0.15
34 0.13
35 0.16
36 0.14
37 0.14
38 0.15
39 0.19
40 0.23
41 0.27
42 0.26
43 0.27
44 0.27
45 0.28
46 0.31
47 0.31
48 0.37
49 0.43
50 0.5
51 0.57
52 0.66
53 0.72
54 0.79
55 0.84
56 0.82
57 0.82
58 0.85
59 0.86
60 0.87
61 0.89
62 0.88
63 0.89
64 0.91
65 0.88
66 0.84
67 0.83
68 0.82
69 0.81
70 0.79
71 0.77
72 0.7
73 0.72
74 0.72
75 0.71
76 0.65
77 0.62
78 0.58
79 0.53
80 0.57
81 0.56
82 0.55
83 0.54
84 0.54
85 0.52
86 0.54
87 0.59
88 0.63
89 0.63
90 0.64
91 0.66
92 0.67