Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J5WL32

Protein Details
Accession A0A1J5WL32   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
99-120LVALKIRKYKRWILLRKNFLAGHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 21, mito 2, E.R. 2, vacu 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MASTRTFVFLSAICILGGVGLLFFHGRRKRRGEHTVKWLFYSCVCFALHFATGLLAITMFHVRFVYPCMSQISPCTRKYGTGYFSCMGSLPLSLLSAVLVALKIRKYKRWILLRKNFLAGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.1
4 0.09
5 0.05
6 0.04
7 0.03
8 0.03
9 0.04
10 0.05
11 0.13
12 0.2
13 0.24
14 0.32
15 0.39
16 0.46
17 0.54
18 0.65
19 0.66
20 0.68
21 0.74
22 0.75
23 0.69
24 0.64
25 0.56
26 0.46
27 0.38
28 0.34
29 0.24
30 0.18
31 0.17
32 0.15
33 0.15
34 0.16
35 0.14
36 0.1
37 0.09
38 0.07
39 0.07
40 0.06
41 0.05
42 0.03
43 0.03
44 0.04
45 0.05
46 0.05
47 0.05
48 0.05
49 0.05
50 0.06
51 0.08
52 0.1
53 0.09
54 0.1
55 0.13
56 0.14
57 0.14
58 0.18
59 0.25
60 0.28
61 0.28
62 0.31
63 0.28
64 0.3
65 0.34
66 0.36
67 0.31
68 0.28
69 0.32
70 0.29
71 0.29
72 0.27
73 0.23
74 0.18
75 0.14
76 0.11
77 0.07
78 0.07
79 0.07
80 0.06
81 0.06
82 0.05
83 0.05
84 0.04
85 0.04
86 0.04
87 0.05
88 0.08
89 0.11
90 0.18
91 0.21
92 0.28
93 0.35
94 0.43
95 0.53
96 0.61
97 0.68
98 0.73
99 0.8
100 0.83
101 0.8