Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J5WJ25

Protein Details
Accession A0A1J5WJ25    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
54-79AMDRRKEGRPSVKRHWRGKLKRALAHBasic
NLS Segment(s)
PositionSequence
57-77RRKEGRPSVKRHWRGKLKRAL
Subcellular Location(s) mito 15, nucl 8.5, cyto_nucl 6, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038253  SRP68_N_sf  
Gene Ontology GO:0003723  F:RNA binding  
Amino Acid Sequences MFLRLLSLQREKHRVLSVCGFSEHIRWCTRQIQRLRKGKADCSVFEAERCFGWAMDRRKEGRPSVKRHWRGKLKRALAHAANIKGEPEKEVAFYKEYLRAHYLCGAGEFQDAFDAFTRVREGIQTGDKIFLEETELFRRYCSYSGGFSFIEDTKEEVPSSPALEEFFLKSFGEQVVRLGDNKSRWRLLKEAKELSLGFPELGVCVAFFVEAVQSLHRREEAEESIRKASLFLDSPSSLSSSIRSSLGRVQQELHRPSQPASGFSESGEVCFPHPLPPVFVGVELGTRKPAADVLSSVFRFLRLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.53
3 0.55
4 0.51
5 0.46
6 0.45
7 0.41
8 0.34
9 0.37
10 0.35
11 0.32
12 0.31
13 0.31
14 0.34
15 0.42
16 0.48
17 0.51
18 0.56
19 0.62
20 0.68
21 0.77
22 0.78
23 0.77
24 0.75
25 0.73
26 0.71
27 0.65
28 0.56
29 0.53
30 0.52
31 0.45
32 0.41
33 0.37
34 0.3
35 0.24
36 0.25
37 0.19
38 0.13
39 0.18
40 0.24
41 0.29
42 0.36
43 0.42
44 0.44
45 0.5
46 0.56
47 0.58
48 0.61
49 0.63
50 0.65
51 0.69
52 0.76
53 0.79
54 0.82
55 0.84
56 0.84
57 0.85
58 0.86
59 0.85
60 0.83
61 0.78
62 0.75
63 0.72
64 0.62
65 0.59
66 0.55
67 0.47
68 0.39
69 0.34
70 0.3
71 0.25
72 0.23
73 0.18
74 0.15
75 0.13
76 0.13
77 0.15
78 0.16
79 0.16
80 0.17
81 0.17
82 0.22
83 0.22
84 0.23
85 0.24
86 0.23
87 0.23
88 0.25
89 0.23
90 0.17
91 0.18
92 0.15
93 0.12
94 0.12
95 0.11
96 0.07
97 0.07
98 0.07
99 0.07
100 0.07
101 0.08
102 0.07
103 0.08
104 0.09
105 0.08
106 0.08
107 0.08
108 0.08
109 0.1
110 0.13
111 0.14
112 0.13
113 0.15
114 0.15
115 0.14
116 0.13
117 0.1
118 0.11
119 0.1
120 0.12
121 0.14
122 0.16
123 0.16
124 0.16
125 0.17
126 0.16
127 0.15
128 0.15
129 0.13
130 0.14
131 0.14
132 0.17
133 0.16
134 0.14
135 0.16
136 0.14
137 0.13
138 0.11
139 0.12
140 0.1
141 0.11
142 0.11
143 0.09
144 0.09
145 0.09
146 0.09
147 0.08
148 0.07
149 0.07
150 0.08
151 0.08
152 0.08
153 0.08
154 0.08
155 0.08
156 0.08
157 0.08
158 0.08
159 0.09
160 0.08
161 0.08
162 0.1
163 0.11
164 0.11
165 0.12
166 0.14
167 0.18
168 0.23
169 0.26
170 0.28
171 0.29
172 0.31
173 0.37
174 0.42
175 0.46
176 0.49
177 0.49
178 0.46
179 0.47
180 0.44
181 0.38
182 0.32
183 0.23
184 0.15
185 0.12
186 0.11
187 0.08
188 0.08
189 0.06
190 0.04
191 0.04
192 0.04
193 0.03
194 0.03
195 0.03
196 0.03
197 0.04
198 0.05
199 0.07
200 0.09
201 0.11
202 0.12
203 0.13
204 0.14
205 0.14
206 0.19
207 0.22
208 0.26
209 0.29
210 0.31
211 0.32
212 0.31
213 0.3
214 0.25
215 0.21
216 0.18
217 0.16
218 0.14
219 0.17
220 0.17
221 0.18
222 0.18
223 0.19
224 0.15
225 0.14
226 0.14
227 0.12
228 0.13
229 0.15
230 0.14
231 0.15
232 0.22
233 0.28
234 0.3
235 0.29
236 0.3
237 0.34
238 0.43
239 0.45
240 0.43
241 0.4
242 0.39
243 0.39
244 0.44
245 0.39
246 0.32
247 0.33
248 0.33
249 0.3
250 0.28
251 0.31
252 0.24
253 0.24
254 0.23
255 0.17
256 0.14
257 0.17
258 0.17
259 0.17
260 0.23
261 0.23
262 0.24
263 0.25
264 0.28
265 0.25
266 0.25
267 0.21
268 0.16
269 0.2
270 0.19
271 0.18
272 0.17
273 0.16
274 0.16
275 0.15
276 0.17
277 0.15
278 0.15
279 0.16
280 0.19
281 0.27
282 0.27
283 0.28
284 0.26