Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J5X604

Protein Details
Accession A0A1J5X604    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MTEMKQTLKRRNEKIKRKVKGILGHydrophilic
NLS Segment(s)
PositionSequence
9-20KRRNEKIKRKVK
Subcellular Location(s) mito 17, cyto_mito 11.833, mito_nucl 10.833, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038765  Papain-like_cys_pep_sf  
IPR003653  Peptidase_C48_C  
Gene Ontology GO:0008234  F:cysteine-type peptidase activity  
GO:0019783  F:ubiquitin-like protein peptidase activity  
GO:0006508  P:proteolysis  
Pfam View protein in Pfam  
PF02902  Peptidase_C48  
PROSITE View protein in PROSITE  
PS50600  ULP_PROTEASE  
Amino Acid Sequences MTEMKQTLKRRNEKIKRKVKGILGLSTEEEQRAKGVLCRDYPHIDLDGLGAAETLAEKFNIAVKKKDAQTLLDTHWLNDEVVNFFFQLIQERSESKTRKCFCFNSFFFTKLTTCGVDSVMRWNAGFEKCDAALIPVNIGNTHWTLLMWCRKRASLFFYDSLQSGLDEETVSLLVGYFRRHNLSVAFHLLDGPAQKNTFDCGVFMCAAAESLSLGRKMYFAPSDAPKIRKAMLHFIWRKSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.9
3 0.88
4 0.85
5 0.83
6 0.79
7 0.77
8 0.71
9 0.66
10 0.59
11 0.53
12 0.48
13 0.42
14 0.36
15 0.29
16 0.24
17 0.18
18 0.15
19 0.15
20 0.13
21 0.15
22 0.2
23 0.23
24 0.26
25 0.29
26 0.33
27 0.35
28 0.36
29 0.34
30 0.3
31 0.24
32 0.21
33 0.19
34 0.15
35 0.11
36 0.09
37 0.07
38 0.05
39 0.05
40 0.05
41 0.05
42 0.04
43 0.04
44 0.05
45 0.05
46 0.1
47 0.16
48 0.18
49 0.21
50 0.24
51 0.31
52 0.34
53 0.38
54 0.35
55 0.32
56 0.34
57 0.34
58 0.33
59 0.34
60 0.31
61 0.26
62 0.26
63 0.24
64 0.2
65 0.17
66 0.16
67 0.11
68 0.11
69 0.11
70 0.1
71 0.09
72 0.09
73 0.08
74 0.12
75 0.11
76 0.12
77 0.13
78 0.14
79 0.17
80 0.24
81 0.28
82 0.27
83 0.35
84 0.38
85 0.42
86 0.46
87 0.47
88 0.44
89 0.5
90 0.47
91 0.44
92 0.42
93 0.38
94 0.33
95 0.31
96 0.27
97 0.19
98 0.19
99 0.13
100 0.11
101 0.11
102 0.11
103 0.1
104 0.1
105 0.13
106 0.13
107 0.12
108 0.12
109 0.12
110 0.14
111 0.14
112 0.15
113 0.11
114 0.12
115 0.11
116 0.12
117 0.11
118 0.09
119 0.1
120 0.09
121 0.09
122 0.08
123 0.08
124 0.08
125 0.08
126 0.08
127 0.07
128 0.08
129 0.07
130 0.06
131 0.07
132 0.12
133 0.2
134 0.22
135 0.24
136 0.25
137 0.27
138 0.29
139 0.3
140 0.31
141 0.28
142 0.3
143 0.29
144 0.29
145 0.29
146 0.27
147 0.25
148 0.19
149 0.13
150 0.1
151 0.08
152 0.07
153 0.06
154 0.06
155 0.05
156 0.05
157 0.05
158 0.04
159 0.04
160 0.05
161 0.06
162 0.09
163 0.11
164 0.13
165 0.16
166 0.17
167 0.18
168 0.2
169 0.23
170 0.24
171 0.26
172 0.24
173 0.21
174 0.21
175 0.19
176 0.18
177 0.16
178 0.15
179 0.14
180 0.13
181 0.14
182 0.14
183 0.17
184 0.18
185 0.15
186 0.14
187 0.13
188 0.15
189 0.15
190 0.14
191 0.12
192 0.1
193 0.1
194 0.1
195 0.08
196 0.06
197 0.07
198 0.09
199 0.09
200 0.1
201 0.1
202 0.11
203 0.12
204 0.16
205 0.17
206 0.16
207 0.22
208 0.26
209 0.35
210 0.4
211 0.42
212 0.41
213 0.42
214 0.43
215 0.42
216 0.42
217 0.43
218 0.44
219 0.52
220 0.55