Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J5WZ18

Protein Details
Accession A0A1J5WZ18    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
4-23NSITRRRRAPYNTRSNKIRPHydrophilic
NLS Segment(s)
PositionSequence
64-67KRMK
Subcellular Location(s) nucl 13, mito 8, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR008195  Ribosomal_L34Ae  
IPR018065  Ribosomal_L34e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01199  Ribosomal_L34e  
PROSITE View protein in PROSITE  
PS01145  RIBOSOMAL_L34E  
Amino Acid Sequences MLQNSITRRRRAPYNTRSNKIRPVRTPGGKLVAQYVPKRGKIPVCGGCKKTLHGIKQARPAAFKRMKKSSRTVARTYGGVLCSKCTRSKILLSVLRKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.77
3 0.79
4 0.81
5 0.77
6 0.78
7 0.76
8 0.74
9 0.68
10 0.67
11 0.69
12 0.68
13 0.67
14 0.6
15 0.57
16 0.49
17 0.44
18 0.39
19 0.33
20 0.32
21 0.29
22 0.34
23 0.32
24 0.33
25 0.34
26 0.33
27 0.32
28 0.31
29 0.37
30 0.37
31 0.4
32 0.44
33 0.44
34 0.45
35 0.43
36 0.4
37 0.39
38 0.37
39 0.32
40 0.36
41 0.41
42 0.42
43 0.5
44 0.54
45 0.47
46 0.46
47 0.45
48 0.46
49 0.48
50 0.48
51 0.46
52 0.52
53 0.57
54 0.58
55 0.64
56 0.63
57 0.65
58 0.66
59 0.64
60 0.6
61 0.56
62 0.52
63 0.47
64 0.4
65 0.31
66 0.29
67 0.25
68 0.23
69 0.25
70 0.27
71 0.29
72 0.29
73 0.32
74 0.33
75 0.39
76 0.41
77 0.47
78 0.52