Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J5WHT2

Protein Details
Accession A0A1J5WHT2    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
3-24RNSLKHPKQIRTRENDHTNRNCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 11.5, mito 6
Family & Domain DBs
Amino Acid Sequences MLRNSLKHPKQIRTRENDHTNRNCDPEKERREKIQGILWDVKPNDETLGRTQELRKGQTQRLVCESLWTVPILANAGIVNTNTKEPGCKKESGETEVLFECSAHSGHGKGQEKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.79
3 0.82
4 0.81
5 0.8
6 0.78
7 0.74
8 0.68
9 0.67
10 0.59
11 0.52
12 0.51
13 0.51
14 0.53
15 0.56
16 0.57
17 0.58
18 0.62
19 0.61
20 0.58
21 0.53
22 0.46
23 0.44
24 0.45
25 0.4
26 0.38
27 0.35
28 0.33
29 0.27
30 0.24
31 0.2
32 0.14
33 0.15
34 0.13
35 0.18
36 0.17
37 0.18
38 0.19
39 0.22
40 0.25
41 0.26
42 0.28
43 0.29
44 0.3
45 0.35
46 0.36
47 0.33
48 0.33
49 0.33
50 0.28
51 0.25
52 0.23
53 0.18
54 0.17
55 0.15
56 0.11
57 0.09
58 0.09
59 0.08
60 0.07
61 0.07
62 0.06
63 0.06
64 0.06
65 0.06
66 0.07
67 0.07
68 0.08
69 0.09
70 0.09
71 0.14
72 0.17
73 0.25
74 0.27
75 0.3
76 0.32
77 0.4
78 0.44
79 0.44
80 0.45
81 0.38
82 0.36
83 0.34
84 0.32
85 0.24
86 0.19
87 0.15
88 0.12
89 0.12
90 0.1
91 0.1
92 0.11
93 0.14
94 0.24