Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J5WFX0

Protein Details
Accession A0A1J5WFX0   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
177-197YVTQYTKIPVRKKSPKQWHGKHydrophilic
NLS Segment(s)
PositionSequence
188-191KKSP
Subcellular Location(s) cyto_nucl 12.833, cyto 12, nucl 11.5, mito_nucl 7.166, cyto_pero 7.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR015338  GT64  
IPR029044  Nucleotide-diphossugar_trans  
Gene Ontology GO:0016020  C:membrane  
GO:0016757  F:glycosyltransferase activity  
Pfam View protein in Pfam  
PF09258  Glyco_transf_64  
Amino Acid Sequences KNELAIVGAQPHFYTKKENEENVRKDKSRLEEVTISYGVLDWKKPRLYTLLSSTGMFLSVEHLFTYTCLLPLEIHLLIDHCGCGADIAMNFLVGGMTRQRGVFVGPHGALETGDPRGSGRETVEEYGGVDLYTKTPQYLGQYCSVPYLSYHQKRARLVRELFYQFDNRDPLQPNNFYVTQYTKIPVRKKSPKQWHGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.26
3 0.36
4 0.42
5 0.49
6 0.55
7 0.63
8 0.7
9 0.71
10 0.75
11 0.67
12 0.63
13 0.62
14 0.59
15 0.58
16 0.52
17 0.49
18 0.46
19 0.46
20 0.48
21 0.41
22 0.34
23 0.25
24 0.23
25 0.19
26 0.16
27 0.17
28 0.15
29 0.21
30 0.24
31 0.25
32 0.26
33 0.28
34 0.31
35 0.33
36 0.36
37 0.37
38 0.35
39 0.34
40 0.33
41 0.28
42 0.24
43 0.19
44 0.13
45 0.09
46 0.09
47 0.09
48 0.08
49 0.08
50 0.08
51 0.08
52 0.11
53 0.08
54 0.08
55 0.08
56 0.08
57 0.08
58 0.09
59 0.12
60 0.09
61 0.09
62 0.08
63 0.08
64 0.09
65 0.09
66 0.08
67 0.04
68 0.05
69 0.04
70 0.04
71 0.04
72 0.04
73 0.04
74 0.05
75 0.05
76 0.05
77 0.05
78 0.05
79 0.05
80 0.03
81 0.04
82 0.04
83 0.04
84 0.05
85 0.05
86 0.06
87 0.06
88 0.07
89 0.08
90 0.08
91 0.11
92 0.1
93 0.1
94 0.1
95 0.1
96 0.09
97 0.08
98 0.09
99 0.06
100 0.06
101 0.06
102 0.06
103 0.08
104 0.08
105 0.09
106 0.09
107 0.1
108 0.12
109 0.13
110 0.13
111 0.12
112 0.12
113 0.11
114 0.1
115 0.07
116 0.06
117 0.05
118 0.06
119 0.08
120 0.08
121 0.07
122 0.08
123 0.1
124 0.15
125 0.19
126 0.2
127 0.22
128 0.23
129 0.24
130 0.25
131 0.24
132 0.18
133 0.15
134 0.19
135 0.25
136 0.3
137 0.38
138 0.42
139 0.47
140 0.53
141 0.61
142 0.62
143 0.61
144 0.59
145 0.56
146 0.59
147 0.57
148 0.52
149 0.47
150 0.45
151 0.36
152 0.37
153 0.36
154 0.29
155 0.32
156 0.34
157 0.37
158 0.4
159 0.42
160 0.4
161 0.41
162 0.4
163 0.35
164 0.34
165 0.33
166 0.29
167 0.28
168 0.29
169 0.29
170 0.37
171 0.43
172 0.48
173 0.55
174 0.62
175 0.71
176 0.79
177 0.84