Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J5XEU4

Protein Details
Accession A0A1J5XEU4    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
106-129MKATNCRKKKCGHSSNLRPKKKIAHydrophilic
NLS Segment(s)
PositionSequence
121-133NLRPKKKIADKKA
Subcellular Location(s) nucl 17, cyto_nucl 15, cyto 5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR038587  L40e_sf  
IPR001975  Ribosomal_L40e  
IPR011332  Ribosomal_zn-bd  
IPR000626  Ubiquitin-like_dom  
IPR029071  Ubiquitin-like_domsf  
IPR019954  Ubiquitin_CS  
IPR019956  Ubiquitin_dom  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01020  Ribosomal_L40e  
PF00240  ubiquitin  
PROSITE View protein in PROSITE  
PS00299  UBIQUITIN_1  
PS50053  UBIQUITIN_2  
CDD cd01803  Ubl_ubiquitin  
Amino Acid Sequences MQIFVKTLTGKTITLEVDSAESIESVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGGPLDPSLRALATKYRCEKQVCRGCYASLPMKATNCRKKKCGHSSNLRPKKKIADKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.15
4 0.14
5 0.13
6 0.12
7 0.09
8 0.08
9 0.07
10 0.08
11 0.08
12 0.07
13 0.1
14 0.15
15 0.18
16 0.21
17 0.24
18 0.29
19 0.3
20 0.37
21 0.39
22 0.37
23 0.36
24 0.37
25 0.37
26 0.35
27 0.34
28 0.27
29 0.25
30 0.25
31 0.24
32 0.21
33 0.21
34 0.17
35 0.2
36 0.2
37 0.18
38 0.16
39 0.16
40 0.15
41 0.13
42 0.13
43 0.1
44 0.16
45 0.17
46 0.18
47 0.2
48 0.19
49 0.18
50 0.18
51 0.19
52 0.15
53 0.14
54 0.11
55 0.13
56 0.14
57 0.14
58 0.15
59 0.13
60 0.11
61 0.11
62 0.11
63 0.09
64 0.09
65 0.11
66 0.11
67 0.11
68 0.12
69 0.11
70 0.11
71 0.1
72 0.1
73 0.14
74 0.18
75 0.24
76 0.29
77 0.31
78 0.37
79 0.42
80 0.45
81 0.49
82 0.54
83 0.5
84 0.5
85 0.49
86 0.45
87 0.42
88 0.43
89 0.38
90 0.33
91 0.33
92 0.31
93 0.33
94 0.4
95 0.48
96 0.53
97 0.57
98 0.58
99 0.61
100 0.67
101 0.74
102 0.77
103 0.77
104 0.77
105 0.79
106 0.84
107 0.9
108 0.93
109 0.9
110 0.82
111 0.77
112 0.77
113 0.77