Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J5WJA9

Protein Details
Accession A0A1J5WJA9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
61-81DNALCVKKNRKTKTIKKEYEVHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 14, E.R. 4, vacu 3, mito 2, plas 2
Family & Domain DBs
Amino Acid Sequences MKIVLLLFVACAHANVVYKTFVSHITWTAVETDFVYATKISRVRTFDPDKRQKTKTVTIVDNALCVKKNRKTKTIKKEYEVYVYTTYTLSVPLFTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.12
4 0.12
5 0.12
6 0.12
7 0.13
8 0.13
9 0.14
10 0.15
11 0.15
12 0.16
13 0.16
14 0.16
15 0.17
16 0.15
17 0.13
18 0.12
19 0.11
20 0.08
21 0.08
22 0.09
23 0.07
24 0.07
25 0.1
26 0.12
27 0.13
28 0.17
29 0.21
30 0.23
31 0.31
32 0.38
33 0.41
34 0.49
35 0.57
36 0.6
37 0.63
38 0.62
39 0.6
40 0.59
41 0.59
42 0.56
43 0.53
44 0.47
45 0.43
46 0.45
47 0.39
48 0.35
49 0.28
50 0.22
51 0.18
52 0.18
53 0.24
54 0.27
55 0.37
56 0.41
57 0.5
58 0.59
59 0.68
60 0.77
61 0.81
62 0.81
63 0.77
64 0.79
65 0.73
66 0.7
67 0.61
68 0.54
69 0.45
70 0.38
71 0.34
72 0.26
73 0.23
74 0.16
75 0.16
76 0.12