Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C0ND91

Protein Details
Accession C0ND91    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
106-128LKRGVIKQEHKKRRGLNQHERMGBasic
NLS Segment(s)
PositionSequence
116-118KKR
Subcellular Location(s) mito 14, nucl 9, cyto_mito 9
Family & Domain DBs
Amino Acid Sequences MAQICVAHAGHWVVKSQRKPAEDVVSRKQSSDDLGASGKIRRGSMMPTQEVYSRGSHLLLERQGYDANSRRSQARGSVYSSQSSNLELSDMGRRLLSAAALSGNMLKRGVIKQEHKKRRGLNQHERMG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.33
3 0.4
4 0.44
5 0.44
6 0.47
7 0.5
8 0.54
9 0.54
10 0.57
11 0.57
12 0.6
13 0.58
14 0.54
15 0.49
16 0.4
17 0.35
18 0.32
19 0.23
20 0.16
21 0.17
22 0.17
23 0.17
24 0.18
25 0.18
26 0.16
27 0.16
28 0.15
29 0.15
30 0.18
31 0.23
32 0.26
33 0.25
34 0.24
35 0.25
36 0.26
37 0.26
38 0.24
39 0.19
40 0.15
41 0.14
42 0.13
43 0.12
44 0.12
45 0.14
46 0.13
47 0.13
48 0.12
49 0.12
50 0.13
51 0.13
52 0.16
53 0.17
54 0.21
55 0.22
56 0.23
57 0.23
58 0.24
59 0.24
60 0.25
61 0.25
62 0.22
63 0.26
64 0.31
65 0.31
66 0.31
67 0.31
68 0.27
69 0.23
70 0.21
71 0.17
72 0.11
73 0.1
74 0.08
75 0.09
76 0.13
77 0.13
78 0.12
79 0.12
80 0.12
81 0.12
82 0.12
83 0.11
84 0.06
85 0.06
86 0.06
87 0.06
88 0.07
89 0.09
90 0.1
91 0.11
92 0.11
93 0.1
94 0.13
95 0.16
96 0.22
97 0.27
98 0.36
99 0.46
100 0.57
101 0.68
102 0.7
103 0.76
104 0.77
105 0.79
106 0.81
107 0.81
108 0.81