Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1F8A6X4

Protein Details
Accession A0A1F8A6X4    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
81-100RATYNPSRRVQKRRHGFLARHydrophilic
NLS Segment(s)
PositionSequence
87-120SRRVQKRRHGFLARVRSRGGRMIILRRRAKGRKS
Subcellular Location(s) nucl 20, cyto_nucl 11.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MPSALRTYSSPMSMSRYLSPKTTTTTPFSTLSSPLRPMTNFTTAIRPQLQTLSNTQLPSAATPSAQQSRSFSASASLAGKRATYNPSRRVQKRRHGFLARVRSRGGRMIILRRRAKGRKSLSW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.3
3 0.32
4 0.32
5 0.34
6 0.35
7 0.31
8 0.34
9 0.36
10 0.34
11 0.34
12 0.36
13 0.36
14 0.35
15 0.34
16 0.3
17 0.29
18 0.29
19 0.27
20 0.26
21 0.24
22 0.25
23 0.24
24 0.26
25 0.27
26 0.27
27 0.26
28 0.24
29 0.3
30 0.28
31 0.32
32 0.3
33 0.26
34 0.22
35 0.24
36 0.24
37 0.19
38 0.21
39 0.22
40 0.22
41 0.21
42 0.2
43 0.18
44 0.17
45 0.16
46 0.15
47 0.09
48 0.07
49 0.08
50 0.11
51 0.14
52 0.15
53 0.16
54 0.16
55 0.19
56 0.21
57 0.21
58 0.18
59 0.15
60 0.14
61 0.15
62 0.15
63 0.12
64 0.11
65 0.11
66 0.12
67 0.11
68 0.13
69 0.17
70 0.23
71 0.3
72 0.37
73 0.45
74 0.54
75 0.62
76 0.69
77 0.74
78 0.76
79 0.79
80 0.8
81 0.81
82 0.78
83 0.76
84 0.76
85 0.78
86 0.73
87 0.65
88 0.59
89 0.52
90 0.49
91 0.48
92 0.41
93 0.36
94 0.36
95 0.43
96 0.49
97 0.56
98 0.59
99 0.59
100 0.66
101 0.68
102 0.69
103 0.69