Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C0NUE1

Protein Details
Accession C0NUE1    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
30-51GDKPTTEKEKENRRRGKRVYDIBasic
NLS Segment(s)
PositionSequence
43-44RR
81-82KR
Subcellular Location(s) mito 13, extr 9, nucl 2, cyto 2, cyto_nucl 2
Family & Domain DBs
Amino Acid Sequences MPWGASLKPTIASSKASCLCFLFRVDPFLGDKPTTEKEKENRRRGKRVYDIWRLATGIADDELDPTLPVARTHPAFGGAKKRRSQRLAGPRIALDNELSLSWLCRHADMYPLPAQDCDTRYLAGFNVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.33
3 0.32
4 0.32
5 0.31
6 0.31
7 0.28
8 0.29
9 0.25
10 0.21
11 0.24
12 0.23
13 0.23
14 0.24
15 0.25
16 0.25
17 0.21
18 0.21
19 0.21
20 0.25
21 0.28
22 0.27
23 0.31
24 0.36
25 0.47
26 0.57
27 0.63
28 0.69
29 0.73
30 0.8
31 0.79
32 0.8
33 0.78
34 0.77
35 0.75
36 0.74
37 0.69
38 0.62
39 0.57
40 0.48
41 0.39
42 0.29
43 0.2
44 0.11
45 0.08
46 0.06
47 0.05
48 0.05
49 0.05
50 0.05
51 0.05
52 0.04
53 0.05
54 0.05
55 0.05
56 0.06
57 0.09
58 0.09
59 0.1
60 0.11
61 0.13
62 0.14
63 0.16
64 0.26
65 0.3
66 0.36
67 0.41
68 0.48
69 0.52
70 0.55
71 0.57
72 0.57
73 0.61
74 0.63
75 0.61
76 0.56
77 0.49
78 0.47
79 0.43
80 0.33
81 0.23
82 0.15
83 0.12
84 0.1
85 0.1
86 0.08
87 0.09
88 0.09
89 0.12
90 0.12
91 0.12
92 0.14
93 0.13
94 0.2
95 0.2
96 0.24
97 0.25
98 0.26
99 0.26
100 0.25
101 0.27
102 0.26
103 0.26
104 0.25
105 0.22
106 0.21
107 0.21
108 0.22