Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C0NRH6

Protein Details
Accession C0NRH6    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
74-105QTPKVEPQEKKKTPKGRAKKRLQYTRRFVNVTHydrophilic
NLS Segment(s)
PositionSequence
45-94HPSKTRPHRLPHIMGKVHGSLARAGKVKSQTPKVEPQEKKKTPKGRAKKR
Subcellular Location(s) mito 13, nucl 11, cyto_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MITLEILLSQRRRSGRVERQTATTTRGSNPKRLLPHSQSHLCRRHPSKTRPHRLPHIMGKVHGSLARAGKVKSQTPKVEPQEKKKTPKGRAKKRLQYTRRFVNVTMTGGKRKMNPNPTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.49
3 0.56
4 0.63
5 0.59
6 0.61
7 0.63
8 0.59
9 0.53
10 0.46
11 0.38
12 0.34
13 0.41
14 0.39
15 0.42
16 0.44
17 0.46
18 0.48
19 0.5
20 0.54
21 0.5
22 0.55
23 0.54
24 0.58
25 0.58
26 0.6
27 0.63
28 0.58
29 0.61
30 0.59
31 0.61
32 0.63
33 0.66
34 0.68
35 0.72
36 0.78
37 0.78
38 0.79
39 0.78
40 0.74
41 0.72
42 0.68
43 0.65
44 0.55
45 0.48
46 0.44
47 0.36
48 0.3
49 0.25
50 0.18
51 0.13
52 0.13
53 0.16
54 0.16
55 0.16
56 0.19
57 0.21
58 0.25
59 0.28
60 0.34
61 0.35
62 0.38
63 0.47
64 0.5
65 0.57
66 0.58
67 0.62
68 0.67
69 0.7
70 0.74
71 0.74
72 0.77
73 0.76
74 0.81
75 0.83
76 0.83
77 0.86
78 0.89
79 0.9
80 0.91
81 0.92
82 0.91
83 0.9
84 0.87
85 0.86
86 0.83
87 0.75
88 0.65
89 0.62
90 0.57
91 0.5
92 0.48
93 0.42
94 0.4
95 0.39
96 0.42
97 0.4
98 0.45
99 0.51