Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C0NME8

Protein Details
Accession C0NME8    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
2-33VELRKRKAPAEPPKPSTKKTKKVTKLDAPAAVHydrophilic
NLS Segment(s)
PositionSequence
5-24RKRKAPAEPPKPSTKKTKKV
Subcellular Location(s) nucl 14.5, cyto_nucl 9, mito 8, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000866  AhpC/TSA  
IPR036249  Thioredoxin-like_sf  
IPR013766  Thioredoxin_domain  
Gene Ontology GO:0016209  F:antioxidant activity  
GO:0016491  F:oxidoreductase activity  
GO:0034599  P:cellular response to oxidative stress  
Pfam View protein in Pfam  
PF00578  AhpC-TSA  
PROSITE View protein in PROSITE  
PS51352  THIOREDOXIN_2  
CDD cd03017  PRX_BCP  
Amino Acid Sequences MVELRKRKAPAEPPKPSTKKTKKVTKLDAPAAVAAIPTPKKEEALNADATPVAPSSQKKPPKIGDTIDLDQIGTNITTHDGAPTTLKSLVEQSASGVVLFTYPRASTPGCTTQVCLFRDRYDKLTSTGLSIFGLSADSPKANANFKSKQNLPYPLLCDPTASLIGALGLKKTPKGTVRGVFVVSKEGKVLLLESGGPAATADAVQKLVESG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.8
3 0.76
4 0.77
5 0.76
6 0.76
7 0.76
8 0.81
9 0.8
10 0.84
11 0.89
12 0.88
13 0.86
14 0.82
15 0.76
16 0.66
17 0.56
18 0.46
19 0.36
20 0.26
21 0.17
22 0.16
23 0.14
24 0.13
25 0.16
26 0.16
27 0.18
28 0.18
29 0.23
30 0.24
31 0.28
32 0.3
33 0.26
34 0.26
35 0.25
36 0.24
37 0.2
38 0.13
39 0.1
40 0.1
41 0.12
42 0.16
43 0.25
44 0.33
45 0.35
46 0.42
47 0.48
48 0.5
49 0.53
50 0.5
51 0.47
52 0.46
53 0.45
54 0.4
55 0.33
56 0.27
57 0.23
58 0.2
59 0.15
60 0.08
61 0.06
62 0.04
63 0.05
64 0.06
65 0.06
66 0.06
67 0.06
68 0.07
69 0.08
70 0.08
71 0.09
72 0.1
73 0.1
74 0.1
75 0.11
76 0.12
77 0.11
78 0.11
79 0.09
80 0.09
81 0.09
82 0.08
83 0.07
84 0.05
85 0.05
86 0.05
87 0.05
88 0.05
89 0.05
90 0.05
91 0.07
92 0.08
93 0.08
94 0.12
95 0.17
96 0.19
97 0.19
98 0.2
99 0.23
100 0.29
101 0.29
102 0.28
103 0.24
104 0.24
105 0.29
106 0.3
107 0.29
108 0.26
109 0.26
110 0.25
111 0.27
112 0.24
113 0.21
114 0.2
115 0.16
116 0.13
117 0.12
118 0.1
119 0.07
120 0.07
121 0.05
122 0.05
123 0.06
124 0.05
125 0.06
126 0.08
127 0.11
128 0.14
129 0.17
130 0.24
131 0.29
132 0.33
133 0.39
134 0.41
135 0.46
136 0.48
137 0.52
138 0.48
139 0.47
140 0.47
141 0.42
142 0.42
143 0.35
144 0.29
145 0.23
146 0.23
147 0.19
148 0.15
149 0.12
150 0.08
151 0.09
152 0.1
153 0.1
154 0.08
155 0.09
156 0.1
157 0.12
158 0.13
159 0.18
160 0.21
161 0.26
162 0.33
163 0.37
164 0.41
165 0.42
166 0.43
167 0.39
168 0.35
169 0.37
170 0.31
171 0.26
172 0.21
173 0.19
174 0.17
175 0.16
176 0.16
177 0.1
178 0.09
179 0.09
180 0.09
181 0.09
182 0.08
183 0.08
184 0.07
185 0.06
186 0.06
187 0.06
188 0.07
189 0.07
190 0.08
191 0.08