Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1F7ZY12

Protein Details
Accession A0A1F7ZY12    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MAFPRRRPRSLSRIREHRRNPATDHydrophilic
NLS Segment(s)
PositionSequence
6-14RRPRSLSRI
Subcellular Location(s) mito 20, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR002110  Ankyrin_rpt  
IPR036770  Ankyrin_rpt-contain_sf  
Pfam View protein in Pfam  
PF12796  Ank_2  
PROSITE View protein in PROSITE  
PS50297  ANK_REP_REGION  
PS50088  ANK_REPEAT  
Amino Acid Sequences MAFPRRRPRSLSRIREHRRNPATDSRGQTPLHIAAQCGHLGVVRLLLTTEQIDVNARDHHGSTPLHVASEKGHVEVVQLLVAHGARLDARSGRTG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.87
3 0.84
4 0.84
5 0.81
6 0.74
7 0.7
8 0.69
9 0.67
10 0.63
11 0.62
12 0.56
13 0.53
14 0.49
15 0.43
16 0.36
17 0.32
18 0.29
19 0.24
20 0.2
21 0.16
22 0.17
23 0.17
24 0.13
25 0.11
26 0.08
27 0.08
28 0.08
29 0.07
30 0.05
31 0.05
32 0.05
33 0.05
34 0.06
35 0.05
36 0.06
37 0.05
38 0.05
39 0.06
40 0.07
41 0.08
42 0.09
43 0.09
44 0.1
45 0.1
46 0.11
47 0.14
48 0.13
49 0.13
50 0.17
51 0.16
52 0.16
53 0.16
54 0.16
55 0.13
56 0.19
57 0.18
58 0.14
59 0.14
60 0.13
61 0.14
62 0.15
63 0.14
64 0.09
65 0.09
66 0.08
67 0.09
68 0.09
69 0.08
70 0.07
71 0.07
72 0.06
73 0.08
74 0.1
75 0.12