Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1F7ZSQ5

Protein Details
Accession A0A1F7ZSQ5   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
126-145IFGAYRKKPVKPSTKKLWSSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 12, cyto 5, mito 3, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR020618  Adenyl_kinase_AK6  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0004017  F:adenylate kinase activity  
GO:0005524  F:ATP binding  
GO:0016887  F:ATP hydrolysis activity  
GO:0016310  P:phosphorylation  
Pfam View protein in Pfam  
PF13238  AAA_18  
Amino Acid Sequences MRTSPNVIITGTPGVGKTVHCEQLAQDTGLRHLSINQVAKDRDCFETYDEELETWIVDEDKLLDAVEDEMLQGGLLIDWHACDLFPKSWIDLIVVLRCPSTSLLYDRLSSRGYKQAKLQENLDAEIFGAYRKKPVKPSTKKLWSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.13
4 0.15
5 0.19
6 0.23
7 0.23
8 0.23
9 0.23
10 0.3
11 0.32
12 0.28
13 0.24
14 0.2
15 0.22
16 0.23
17 0.23
18 0.14
19 0.14
20 0.16
21 0.2
22 0.24
23 0.24
24 0.27
25 0.28
26 0.29
27 0.3
28 0.29
29 0.26
30 0.23
31 0.22
32 0.19
33 0.22
34 0.22
35 0.21
36 0.18
37 0.15
38 0.14
39 0.13
40 0.11
41 0.07
42 0.06
43 0.05
44 0.04
45 0.04
46 0.05
47 0.05
48 0.05
49 0.05
50 0.05
51 0.05
52 0.05
53 0.05
54 0.04
55 0.04
56 0.03
57 0.03
58 0.03
59 0.03
60 0.02
61 0.02
62 0.02
63 0.02
64 0.02
65 0.02
66 0.03
67 0.03
68 0.03
69 0.04
70 0.07
71 0.07
72 0.09
73 0.09
74 0.1
75 0.11
76 0.12
77 0.12
78 0.11
79 0.13
80 0.13
81 0.14
82 0.14
83 0.13
84 0.12
85 0.13
86 0.11
87 0.11
88 0.11
89 0.13
90 0.17
91 0.19
92 0.21
93 0.21
94 0.23
95 0.22
96 0.22
97 0.22
98 0.26
99 0.28
100 0.29
101 0.35
102 0.42
103 0.49
104 0.51
105 0.49
106 0.47
107 0.46
108 0.44
109 0.38
110 0.29
111 0.2
112 0.17
113 0.15
114 0.11
115 0.12
116 0.11
117 0.19
118 0.23
119 0.28
120 0.37
121 0.47
122 0.57
123 0.64
124 0.73
125 0.76