Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1F8AH60

Protein Details
Accession A0A1F8AH60    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
224-249PLWMLSKVERRKLRRKFRGTQGLCLDHydrophilic
NLS Segment(s)
PositionSequence
233-239RRKLRRK
Subcellular Location(s) cyto 12, cyto_nucl 9, pero 6, nucl 4, mito 2, extr 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR022085  OpdG  
Pfam View protein in Pfam  
PF12311  DUF3632  
Amino Acid Sequences MDPIHLKIEAPTPHDFETPIQTIITAAIQPTNALPAKDAALALDTGYVDYIKNPGMDPAGVLTCFWELINSFASQIPYESPAQEKLVAIVQELAGVTSKQTILNQKLWRNVPYFASEFPQSWEAVSPDATDDEKKRRFVNLQAYAARVLGLGLVPLEMYAIWALSDVAEGVMLPVRGSPDVVSADPSDVDQLPFKAAAAGVWILYAAHALYGRDEAIGGTQGGPLWMLSKVERRKLRRKFRGTQGLCLDRWLLWKQQFGAIRDCGLADADTRTLAGNVVETMDRVEGHS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.33
3 0.28
4 0.32
5 0.3
6 0.27
7 0.23
8 0.2
9 0.19
10 0.19
11 0.18
12 0.11
13 0.09
14 0.09
15 0.1
16 0.1
17 0.1
18 0.15
19 0.15
20 0.15
21 0.15
22 0.15
23 0.17
24 0.18
25 0.17
26 0.12
27 0.11
28 0.11
29 0.1
30 0.1
31 0.08
32 0.07
33 0.07
34 0.07
35 0.06
36 0.07
37 0.08
38 0.09
39 0.1
40 0.1
41 0.11
42 0.12
43 0.12
44 0.12
45 0.12
46 0.12
47 0.11
48 0.11
49 0.1
50 0.09
51 0.1
52 0.09
53 0.08
54 0.06
55 0.08
56 0.1
57 0.09
58 0.1
59 0.11
60 0.12
61 0.12
62 0.12
63 0.12
64 0.13
65 0.14
66 0.13
67 0.14
68 0.15
69 0.16
70 0.17
71 0.16
72 0.14
73 0.16
74 0.15
75 0.13
76 0.12
77 0.1
78 0.1
79 0.1
80 0.09
81 0.06
82 0.06
83 0.06
84 0.06
85 0.07
86 0.07
87 0.1
88 0.16
89 0.2
90 0.27
91 0.33
92 0.36
93 0.42
94 0.44
95 0.45
96 0.4
97 0.38
98 0.32
99 0.3
100 0.28
101 0.22
102 0.22
103 0.2
104 0.18
105 0.18
106 0.17
107 0.13
108 0.12
109 0.12
110 0.1
111 0.1
112 0.1
113 0.08
114 0.07
115 0.08
116 0.09
117 0.1
118 0.12
119 0.2
120 0.23
121 0.25
122 0.26
123 0.28
124 0.3
125 0.34
126 0.41
127 0.39
128 0.4
129 0.39
130 0.39
131 0.36
132 0.34
133 0.27
134 0.17
135 0.1
136 0.05
137 0.04
138 0.03
139 0.03
140 0.03
141 0.02
142 0.02
143 0.02
144 0.02
145 0.03
146 0.03
147 0.03
148 0.02
149 0.03
150 0.03
151 0.03
152 0.03
153 0.03
154 0.03
155 0.03
156 0.03
157 0.03
158 0.04
159 0.04
160 0.04
161 0.04
162 0.05
163 0.06
164 0.06
165 0.06
166 0.07
167 0.09
168 0.09
169 0.1
170 0.1
171 0.1
172 0.1
173 0.1
174 0.1
175 0.09
176 0.09
177 0.09
178 0.09
179 0.09
180 0.09
181 0.09
182 0.08
183 0.07
184 0.06
185 0.07
186 0.07
187 0.06
188 0.06
189 0.06
190 0.05
191 0.05
192 0.05
193 0.03
194 0.04
195 0.04
196 0.05
197 0.05
198 0.06
199 0.07
200 0.06
201 0.07
202 0.06
203 0.06
204 0.07
205 0.07
206 0.06
207 0.07
208 0.07
209 0.07
210 0.07
211 0.06
212 0.06
213 0.07
214 0.08
215 0.1
216 0.19
217 0.25
218 0.33
219 0.42
220 0.5
221 0.6
222 0.69
223 0.78
224 0.8
225 0.84
226 0.85
227 0.87
228 0.9
229 0.83
230 0.81
231 0.79
232 0.74
233 0.64
234 0.56
235 0.47
236 0.36
237 0.38
238 0.32
239 0.3
240 0.28
241 0.32
242 0.32
243 0.37
244 0.42
245 0.4
246 0.43
247 0.37
248 0.35
249 0.31
250 0.29
251 0.23
252 0.19
253 0.16
254 0.12
255 0.12
256 0.11
257 0.11
258 0.11
259 0.11
260 0.1
261 0.11
262 0.1
263 0.08
264 0.08
265 0.1
266 0.1
267 0.09
268 0.11
269 0.11