Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C0NSK0

Protein Details
Accession C0NSK0   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
31-55RVDVGEQGKKKKKKQKDHQGWDWYFBasic
82-105TSLQTCKIFKKKDKGVKCPGVKGCHydrophilic
NLS Segment(s)
PositionSequence
37-46QGKKKKKKQK
Subcellular Location(s) mito 11.5, mito_nucl 11.333, nucl 10, cyto_nucl 7.833, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MRRSFVYKALEMKSSGWDAGGNRDGFGRRSRVDVGEQGKKKKKKQKDHQGWDWYFILPGRELLHSYEKFSRTPRITTFPLLTSLQTCKIFKKKDKGVKCPGVKGCPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.25
3 0.19
4 0.18
5 0.16
6 0.21
7 0.25
8 0.21
9 0.19
10 0.22
11 0.23
12 0.23
13 0.26
14 0.25
15 0.2
16 0.24
17 0.26
18 0.26
19 0.27
20 0.31
21 0.33
22 0.38
23 0.41
24 0.47
25 0.54
26 0.59
27 0.65
28 0.69
29 0.73
30 0.75
31 0.82
32 0.84
33 0.87
34 0.89
35 0.89
36 0.89
37 0.8
38 0.72
39 0.61
40 0.5
41 0.39
42 0.3
43 0.21
44 0.11
45 0.11
46 0.09
47 0.08
48 0.09
49 0.11
50 0.18
51 0.18
52 0.21
53 0.25
54 0.25
55 0.26
56 0.28
57 0.34
58 0.3
59 0.34
60 0.35
61 0.36
62 0.37
63 0.39
64 0.39
65 0.32
66 0.32
67 0.29
68 0.26
69 0.22
70 0.22
71 0.24
72 0.26
73 0.26
74 0.29
75 0.38
76 0.46
77 0.52
78 0.59
79 0.65
80 0.71
81 0.8
82 0.82
83 0.84
84 0.86
85 0.83
86 0.82
87 0.79