Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1F7ZNP8

Protein Details
Accession A0A1F7ZNP8    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
43-63TASNAKPGKKRRPDEDRLMSAHydrophilic
NLS Segment(s)
PositionSequence
17-55GKLSRSAPAPSKPKKAIRTPSAPARVTASNAKPGKKRRP
272-277NHRGRR
Subcellular Location(s) nucl 16, mito 5.5, cyto_mito 5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
CDD cd00590  RRM_SF  
Amino Acid Sequences MAAGQQAVSFNEIIKAGKLSRSAPAPSKPKKAIRTPSAPARVTASNAKPGKKRRPDEDRLMSALNPASGQATVRDAPVGLSIKGAGSGPFVVVGGNFAPGTTAADIQSALEPVTGNILRCWVTSQHPTVTAEVTFAEKWAAESAIANFHNQRADGRILSMRMKSGSAGSQGQDLFERSAGTQNSFSDLREQENRKRMLHRGADPAVQDGSYGFGGQNQAAGRDDASGNRNNRRNFRGNRNTGTSRNQAQQSNEQSLYSDQMMVDAPPRNPRNHRGRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.15
3 0.15
4 0.19
5 0.21
6 0.21
7 0.25
8 0.29
9 0.32
10 0.36
11 0.43
12 0.49
13 0.55
14 0.62
15 0.66
16 0.7
17 0.73
18 0.77
19 0.78
20 0.77
21 0.77
22 0.75
23 0.77
24 0.77
25 0.69
26 0.6
27 0.54
28 0.47
29 0.42
30 0.43
31 0.36
32 0.37
33 0.4
34 0.45
35 0.48
36 0.56
37 0.64
38 0.66
39 0.7
40 0.71
41 0.77
42 0.79
43 0.82
44 0.81
45 0.75
46 0.68
47 0.62
48 0.52
49 0.44
50 0.37
51 0.26
52 0.17
53 0.13
54 0.1
55 0.09
56 0.09
57 0.08
58 0.1
59 0.11
60 0.11
61 0.11
62 0.1
63 0.1
64 0.14
65 0.14
66 0.11
67 0.11
68 0.11
69 0.1
70 0.11
71 0.11
72 0.07
73 0.06
74 0.06
75 0.06
76 0.06
77 0.06
78 0.05
79 0.05
80 0.06
81 0.05
82 0.05
83 0.05
84 0.05
85 0.05
86 0.05
87 0.07
88 0.07
89 0.07
90 0.06
91 0.07
92 0.07
93 0.07
94 0.08
95 0.06
96 0.06
97 0.05
98 0.05
99 0.05
100 0.09
101 0.09
102 0.09
103 0.09
104 0.1
105 0.1
106 0.11
107 0.12
108 0.1
109 0.13
110 0.17
111 0.19
112 0.19
113 0.2
114 0.21
115 0.2
116 0.19
117 0.16
118 0.12
119 0.1
120 0.11
121 0.08
122 0.07
123 0.07
124 0.06
125 0.06
126 0.06
127 0.06
128 0.04
129 0.05
130 0.06
131 0.1
132 0.1
133 0.11
134 0.11
135 0.12
136 0.12
137 0.12
138 0.12
139 0.11
140 0.12
141 0.11
142 0.13
143 0.13
144 0.14
145 0.16
146 0.17
147 0.14
148 0.13
149 0.13
150 0.12
151 0.12
152 0.11
153 0.12
154 0.13
155 0.12
156 0.14
157 0.14
158 0.14
159 0.14
160 0.13
161 0.11
162 0.1
163 0.1
164 0.08
165 0.13
166 0.13
167 0.15
168 0.15
169 0.15
170 0.18
171 0.18
172 0.18
173 0.19
174 0.19
175 0.21
176 0.28
177 0.33
178 0.37
179 0.45
180 0.49
181 0.46
182 0.5
183 0.51
184 0.52
185 0.54
186 0.51
187 0.51
188 0.49
189 0.48
190 0.44
191 0.41
192 0.32
193 0.25
194 0.2
195 0.12
196 0.11
197 0.09
198 0.09
199 0.06
200 0.08
201 0.09
202 0.09
203 0.12
204 0.1
205 0.12
206 0.12
207 0.13
208 0.11
209 0.12
210 0.13
211 0.14
212 0.18
213 0.23
214 0.28
215 0.36
216 0.43
217 0.47
218 0.54
219 0.59
220 0.65
221 0.66
222 0.72
223 0.74
224 0.75
225 0.76
226 0.77
227 0.75
228 0.7
229 0.69
230 0.64
231 0.59
232 0.57
233 0.56
234 0.52
235 0.52
236 0.56
237 0.55
238 0.55
239 0.51
240 0.44
241 0.4
242 0.37
243 0.35
244 0.27
245 0.21
246 0.14
247 0.14
248 0.15
249 0.14
250 0.17
251 0.19
252 0.21
253 0.29
254 0.34
255 0.41
256 0.47
257 0.56