Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C0NCA3

Protein Details
Accession C0NCA3    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
106-132PKFHSHLHGTKKEKRKKKQFICTTYIAHydrophilic
NLS Segment(s)
PositionSequence
115-123TKKEKRKKK
Subcellular Location(s) mito 13, nucl 12, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MPAKVGNLGRKRRLTSEATLRSISSQRQLMEKRGNIGQNNADNRKSTVKVWKRGKVVVISLRNSEIPETCPGNKAVQKRLKLRHVDFQALHSLKLASYALQTAQHPKFHSHLHGTKKEKRKKKQFICTTYIALVGRNDEHGSLSLIKIWSRSKNFTMSAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.58
3 0.6
4 0.59
5 0.56
6 0.53
7 0.48
8 0.46
9 0.44
10 0.38
11 0.33
12 0.29
13 0.26
14 0.34
15 0.36
16 0.4
17 0.46
18 0.45
19 0.43
20 0.44
21 0.48
22 0.41
23 0.42
24 0.4
25 0.39
26 0.44
27 0.44
28 0.4
29 0.36
30 0.38
31 0.39
32 0.35
33 0.31
34 0.35
35 0.4
36 0.48
37 0.56
38 0.6
39 0.59
40 0.6
41 0.59
42 0.51
43 0.48
44 0.47
45 0.43
46 0.38
47 0.35
48 0.34
49 0.31
50 0.28
51 0.23
52 0.16
53 0.13
54 0.14
55 0.16
56 0.15
57 0.16
58 0.17
59 0.21
60 0.23
61 0.25
62 0.31
63 0.34
64 0.4
65 0.46
66 0.51
67 0.55
68 0.58
69 0.57
70 0.56
71 0.53
72 0.51
73 0.44
74 0.39
75 0.4
76 0.33
77 0.31
78 0.23
79 0.2
80 0.15
81 0.16
82 0.14
83 0.06
84 0.06
85 0.07
86 0.07
87 0.09
88 0.1
89 0.17
90 0.19
91 0.22
92 0.23
93 0.25
94 0.27
95 0.28
96 0.31
97 0.31
98 0.35
99 0.41
100 0.49
101 0.54
102 0.6
103 0.68
104 0.74
105 0.76
106 0.8
107 0.83
108 0.86
109 0.89
110 0.91
111 0.91
112 0.89
113 0.85
114 0.78
115 0.69
116 0.59
117 0.52
118 0.41
119 0.32
120 0.25
121 0.21
122 0.18
123 0.17
124 0.16
125 0.14
126 0.15
127 0.14
128 0.16
129 0.15
130 0.14
131 0.16
132 0.17
133 0.17
134 0.2
135 0.25
136 0.31
137 0.36
138 0.42
139 0.42
140 0.47