Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1F7ZTL6

Protein Details
Accession A0A1F7ZTL6    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
9-37KAEDLTRVRNNQRRCRQRKRDYVAELERRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 13, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Amino Acid Sequences MPRIKQKTKAEDLTRVRNNQRRCRQRKRDYVAELERRLTSIEDTTSREIQRLQSIVDELRQANERLTALLYSGGTDCGSIGPLRQTESENDALRDMSSDLVPLGDASILGKAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.72
3 0.72
4 0.71
5 0.75
6 0.75
7 0.79
8 0.8
9 0.83
10 0.87
11 0.88
12 0.91
13 0.92
14 0.9
15 0.89
16 0.83
17 0.82
18 0.8
19 0.77
20 0.69
21 0.6
22 0.51
23 0.42
24 0.38
25 0.29
26 0.2
27 0.13
28 0.13
29 0.13
30 0.16
31 0.19
32 0.21
33 0.21
34 0.2
35 0.2
36 0.19
37 0.2
38 0.18
39 0.15
40 0.12
41 0.13
42 0.13
43 0.12
44 0.12
45 0.09
46 0.1
47 0.11
48 0.11
49 0.1
50 0.11
51 0.1
52 0.09
53 0.1
54 0.08
55 0.07
56 0.08
57 0.07
58 0.06
59 0.07
60 0.07
61 0.06
62 0.06
63 0.06
64 0.05
65 0.06
66 0.05
67 0.06
68 0.08
69 0.09
70 0.11
71 0.13
72 0.14
73 0.16
74 0.21
75 0.26
76 0.25
77 0.25
78 0.23
79 0.23
80 0.21
81 0.2
82 0.15
83 0.11
84 0.09
85 0.09
86 0.08
87 0.08
88 0.08
89 0.07
90 0.07
91 0.05
92 0.05
93 0.05