Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1F7ZSV9

Protein Details
Accession A0A1F7ZSV9   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
15-35RSLNRKWQRLVARRNENNDGLHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 20, mito 3, E.R. 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR003370  Chromate_transpt  
Gene Ontology GO:0005886  C:plasma membrane  
GO:0015109  F:chromate transmembrane transporter activity  
Pfam View protein in Pfam  
PF02417  Chromate_transp  
Amino Acid Sequences MLLPASFSRHITSLRSLNRKWQRLVARRNENNDGLSSRMVDVFLRTWDLGFTSFGGPPVHFRILHERFVQGKGGKEKWVDEQTYQELFAICQGLPGPGSTKMIFCLTLLHAGFIPALLVFFTWSLPGAIGMYALSLGVQKIGDTLPLPVYALLSGLNSSTVGIVALAAVQLAEKAIRDKLTRILVIFGACAGLCYNSLWYFPLLMVAGGLACIIWDGWMSQRIRKMKLAWRRRHTVQPTTETELVTMQSIPLEEGGRAAVPSPNGDTAASQMNPVRSRNVGLGGESVALSSADTRPDQGAEEYPAPAHSIRVRVGILITVCFFASFIGLLVGRSVSHQPPLALDLFTNMYLAGTIIFGGGPVVIPLLRSYVVGPGWVSSRDFLLGLAIIQAFPGPNFNFAVYLGALALQYSQFPTIFGAFLGGLGIFFPGIALAVAVQSFWKTLRKRKWVVDFLRGVNATAVGLVFTAVYRLWEIGYLTPEASNGQSLAKEPWWVVIAVVTYAESAWFNVPSALAIIIGAILGLCWYGAVGHQAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.51
3 0.5
4 0.58
5 0.66
6 0.69
7 0.67
8 0.67
9 0.68
10 0.7
11 0.79
12 0.79
13 0.8
14 0.79
15 0.83
16 0.81
17 0.73
18 0.65
19 0.58
20 0.49
21 0.4
22 0.34
23 0.28
24 0.22
25 0.2
26 0.18
27 0.15
28 0.16
29 0.15
30 0.16
31 0.18
32 0.16
33 0.16
34 0.16
35 0.16
36 0.15
37 0.14
38 0.14
39 0.14
40 0.14
41 0.17
42 0.18
43 0.17
44 0.19
45 0.25
46 0.26
47 0.24
48 0.26
49 0.35
50 0.38
51 0.43
52 0.41
53 0.39
54 0.38
55 0.4
56 0.44
57 0.36
58 0.38
59 0.4
60 0.41
61 0.42
62 0.41
63 0.41
64 0.43
65 0.47
66 0.43
67 0.36
68 0.39
69 0.39
70 0.38
71 0.36
72 0.29
73 0.22
74 0.19
75 0.2
76 0.16
77 0.11
78 0.11
79 0.11
80 0.1
81 0.1
82 0.11
83 0.11
84 0.11
85 0.15
86 0.15
87 0.15
88 0.16
89 0.17
90 0.17
91 0.14
92 0.16
93 0.14
94 0.19
95 0.19
96 0.18
97 0.16
98 0.16
99 0.16
100 0.12
101 0.11
102 0.05
103 0.05
104 0.04
105 0.04
106 0.04
107 0.05
108 0.05
109 0.05
110 0.06
111 0.06
112 0.06
113 0.06
114 0.06
115 0.05
116 0.05
117 0.05
118 0.04
119 0.04
120 0.04
121 0.04
122 0.04
123 0.04
124 0.05
125 0.05
126 0.05
127 0.06
128 0.06
129 0.07
130 0.07
131 0.09
132 0.09
133 0.09
134 0.09
135 0.08
136 0.09
137 0.08
138 0.07
139 0.06
140 0.05
141 0.05
142 0.05
143 0.05
144 0.05
145 0.05
146 0.05
147 0.04
148 0.04
149 0.04
150 0.04
151 0.03
152 0.03
153 0.03
154 0.03
155 0.02
156 0.02
157 0.02
158 0.03
159 0.03
160 0.04
161 0.05
162 0.07
163 0.1
164 0.11
165 0.13
166 0.18
167 0.22
168 0.23
169 0.22
170 0.21
171 0.2
172 0.19
173 0.17
174 0.12
175 0.08
176 0.07
177 0.07
178 0.05
179 0.05
180 0.05
181 0.05
182 0.07
183 0.07
184 0.07
185 0.08
186 0.08
187 0.08
188 0.07
189 0.08
190 0.07
191 0.06
192 0.06
193 0.05
194 0.04
195 0.04
196 0.04
197 0.02
198 0.02
199 0.02
200 0.02
201 0.02
202 0.02
203 0.03
204 0.04
205 0.1
206 0.11
207 0.14
208 0.2
209 0.24
210 0.27
211 0.3
212 0.35
213 0.37
214 0.47
215 0.55
216 0.59
217 0.62
218 0.66
219 0.66
220 0.7
221 0.68
222 0.66
223 0.61
224 0.57
225 0.55
226 0.53
227 0.51
228 0.41
229 0.35
230 0.27
231 0.22
232 0.16
233 0.12
234 0.07
235 0.05
236 0.05
237 0.05
238 0.05
239 0.05
240 0.05
241 0.05
242 0.05
243 0.05
244 0.05
245 0.06
246 0.06
247 0.05
248 0.06
249 0.07
250 0.07
251 0.08
252 0.08
253 0.07
254 0.08
255 0.1
256 0.1
257 0.09
258 0.11
259 0.14
260 0.15
261 0.16
262 0.16
263 0.14
264 0.15
265 0.15
266 0.17
267 0.14
268 0.12
269 0.12
270 0.11
271 0.1
272 0.09
273 0.08
274 0.05
275 0.05
276 0.04
277 0.05
278 0.05
279 0.06
280 0.06
281 0.07
282 0.08
283 0.08
284 0.09
285 0.09
286 0.1
287 0.11
288 0.12
289 0.11
290 0.11
291 0.11
292 0.11
293 0.1
294 0.1
295 0.1
296 0.12
297 0.12
298 0.14
299 0.14
300 0.13
301 0.13
302 0.13
303 0.11
304 0.09
305 0.09
306 0.07
307 0.07
308 0.07
309 0.07
310 0.05
311 0.05
312 0.04
313 0.04
314 0.04
315 0.04
316 0.04
317 0.05
318 0.05
319 0.05
320 0.06
321 0.09
322 0.09
323 0.11
324 0.12
325 0.12
326 0.12
327 0.15
328 0.15
329 0.12
330 0.11
331 0.1
332 0.11
333 0.11
334 0.1
335 0.07
336 0.06
337 0.06
338 0.06
339 0.04
340 0.03
341 0.03
342 0.03
343 0.03
344 0.03
345 0.03
346 0.03
347 0.03
348 0.03
349 0.03
350 0.03
351 0.03
352 0.04
353 0.05
354 0.06
355 0.06
356 0.07
357 0.09
358 0.09
359 0.1
360 0.1
361 0.09
362 0.11
363 0.11
364 0.11
365 0.09
366 0.1
367 0.1
368 0.1
369 0.09
370 0.08
371 0.07
372 0.06
373 0.07
374 0.06
375 0.05
376 0.05
377 0.06
378 0.05
379 0.05
380 0.09
381 0.09
382 0.11
383 0.12
384 0.12
385 0.12
386 0.12
387 0.14
388 0.1
389 0.09
390 0.07
391 0.07
392 0.07
393 0.06
394 0.06
395 0.05
396 0.05
397 0.06
398 0.07
399 0.07
400 0.07
401 0.09
402 0.09
403 0.09
404 0.09
405 0.09
406 0.08
407 0.08
408 0.08
409 0.06
410 0.05
411 0.05
412 0.05
413 0.03
414 0.03
415 0.03
416 0.03
417 0.03
418 0.03
419 0.03
420 0.03
421 0.03
422 0.04
423 0.04
424 0.04
425 0.04
426 0.05
427 0.07
428 0.15
429 0.21
430 0.31
431 0.41
432 0.51
433 0.58
434 0.66
435 0.75
436 0.77
437 0.78
438 0.77
439 0.73
440 0.66
441 0.66
442 0.57
443 0.47
444 0.37
445 0.31
446 0.22
447 0.16
448 0.13
449 0.06
450 0.06
451 0.05
452 0.05
453 0.04
454 0.05
455 0.05
456 0.06
457 0.07
458 0.07
459 0.07
460 0.09
461 0.1
462 0.12
463 0.14
464 0.14
465 0.14
466 0.14
467 0.14
468 0.14
469 0.14
470 0.12
471 0.11
472 0.11
473 0.11
474 0.13
475 0.16
476 0.16
477 0.18
478 0.17
479 0.19
480 0.19
481 0.18
482 0.16
483 0.15
484 0.14
485 0.12
486 0.12
487 0.1
488 0.08
489 0.08
490 0.09
491 0.07
492 0.08
493 0.1
494 0.1
495 0.1
496 0.11
497 0.11
498 0.1
499 0.11
500 0.1
501 0.08
502 0.07
503 0.06
504 0.05
505 0.05
506 0.04
507 0.03
508 0.03
509 0.03
510 0.03
511 0.03
512 0.02
513 0.03
514 0.03
515 0.04