Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1F7ZQ16

Protein Details
Accession A0A1F7ZQ16    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
83-110ASPAKTASPPKKRCVKRKNKSEPGDDDVHydrophilic
NLS Segment(s)
PositionSequence
92-100PKKRCVKRK
Subcellular Location(s) nucl 17.5, mito_nucl 12.5, mito 6.5
Family & Domain DBs
Amino Acid Sequences MKPANPRPKAKPDEHLVFLYLCLVNSGGANNIDFNAVAVASNINVPAARMRWTRLKARIEKEMTDSSGDPNEGEPSAASTPAASPAKTASPPKKRCVKRKNKSEPGDDDVAENNDESNPTAEAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.58
3 0.49
4 0.41
5 0.36
6 0.3
7 0.22
8 0.15
9 0.11
10 0.1
11 0.09
12 0.09
13 0.09
14 0.08
15 0.08
16 0.08
17 0.08
18 0.08
19 0.08
20 0.08
21 0.07
22 0.06
23 0.05
24 0.05
25 0.05
26 0.04
27 0.04
28 0.05
29 0.04
30 0.04
31 0.04
32 0.05
33 0.06
34 0.07
35 0.11
36 0.11
37 0.14
38 0.21
39 0.25
40 0.32
41 0.38
42 0.45
43 0.48
44 0.51
45 0.56
46 0.51
47 0.49
48 0.47
49 0.41
50 0.33
51 0.28
52 0.25
53 0.17
54 0.16
55 0.15
56 0.1
57 0.09
58 0.1
59 0.08
60 0.08
61 0.06
62 0.08
63 0.08
64 0.08
65 0.08
66 0.07
67 0.07
68 0.13
69 0.14
70 0.12
71 0.12
72 0.13
73 0.16
74 0.19
75 0.27
76 0.31
77 0.4
78 0.46
79 0.54
80 0.62
81 0.69
82 0.77
83 0.81
84 0.82
85 0.82
86 0.88
87 0.92
88 0.92
89 0.9
90 0.88
91 0.83
92 0.78
93 0.72
94 0.61
95 0.51
96 0.43
97 0.38
98 0.29
99 0.22
100 0.17
101 0.13
102 0.14
103 0.13
104 0.12