Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C0P1A7

Protein Details
Accession C0P1A7    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
61-115EKYFSEKKSLKKKKSLKKKKSLKKKKSLKKKKSSEKKKSSEKKKSLNVKSLKIKSBasic
NLS Segment(s)
PositionSequence
32-38KSSEKKS
43-43K
46-114EMKFLKIKSLEKKSSEKYFSEKKSLKKKKSLKKKKSLKKKKSLKKKKSSEKKKSSEKKKSLNVKSLKIK
Subcellular Location(s) nucl 21, cyto_nucl 13, mito 3, cyto 3
Family & Domain DBs
Amino Acid Sequences MESSDKLLEDKFLKKESSEEKKFSEIKSLKMKSSEKKSSEEEKSSEMKFLKIKSLEKKSSEKYFSEKKSLKKKKSLKKKKSLKKKKSLKKKKSSEKKKSSEKKKSLNVKSLKIKSSEKESSEKYFSEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.37
3 0.43
4 0.49
5 0.5
6 0.49
7 0.49
8 0.55
9 0.58
10 0.51
11 0.52
12 0.44
13 0.44
14 0.5
15 0.5
16 0.45
17 0.49
18 0.54
19 0.52
20 0.6
21 0.62
22 0.54
23 0.56
24 0.59
25 0.6
26 0.6
27 0.56
28 0.48
29 0.43
30 0.44
31 0.4
32 0.38
33 0.3
34 0.27
35 0.26
36 0.25
37 0.27
38 0.26
39 0.32
40 0.36
41 0.44
42 0.46
43 0.47
44 0.52
45 0.51
46 0.54
47 0.51
48 0.44
49 0.41
50 0.45
51 0.43
52 0.46
53 0.46
54 0.47
55 0.55
56 0.64
57 0.65
58 0.67
59 0.74
60 0.75
61 0.82
62 0.86
63 0.85
64 0.86
65 0.9
66 0.9
67 0.92
68 0.93
69 0.92
70 0.92
71 0.92
72 0.91
73 0.92
74 0.93
75 0.93
76 0.92
77 0.92
78 0.93
79 0.93
80 0.95
81 0.95
82 0.94
83 0.93
84 0.93
85 0.93
86 0.93
87 0.93
88 0.91
89 0.89
90 0.88
91 0.89
92 0.86
93 0.86
94 0.81
95 0.79
96 0.8
97 0.77
98 0.72
99 0.67
100 0.64
101 0.59
102 0.61
103 0.59
104 0.52
105 0.53
106 0.54
107 0.55
108 0.53