Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1F7ZXQ2

Protein Details
Accession A0A1F7ZXQ2    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
298-317IRLAKESKKDRAKRGGQAKGBasic
NLS Segment(s)
PositionSequence
303-314ESKKDRAKRGGQ
336-384RLTRRAKGSGGALDRSRKRKHGEDGPRGDGAAVGQIFEKRRKKIEGWKR
Subcellular Location(s) nucl 14.5, cyto_nucl 13.5, cyto 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007146  Sas10/Utp3/C1D  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
Pfam View protein in Pfam  
PF04000  Sas10_Utp3  
Amino Acid Sequences METATQQPENSGLQNISALLETITGCLTTAGSSLPKDKRDAPSEVSIEPPQDGISLLDTKSDLLLSYIHNLVFLMLFQLRGLSKDRDSDAEADHSLREETVKKLAELRVYLDRGVRPLEGRLKYQIDKVVKAAEDAERAERTAAKTKATQAEDSGSDNESASEKDSSDGEGDSAEGSDDDQEDIDEMAYRPNVSAFAKKVEPESRAEKSTKKAPSDGIYRPPKIMPTALPTTETRERRERGPRRSTVIDEFVNAEMSSAPMAEPSIGSTIVHGGRHTKSKKEREHETERTTYEETNFIRLAKESKKDRAKRGGQAKGTYGGEEWRGLTEGADRISRLTRRAKGSGGALDRSRKRKHGEDGPRGDGAAVGQIFEKRRKKIEGWKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.15
4 0.13
5 0.11
6 0.08
7 0.09
8 0.08
9 0.08
10 0.08
11 0.07
12 0.07
13 0.07
14 0.07
15 0.06
16 0.07
17 0.08
18 0.1
19 0.12
20 0.2
21 0.26
22 0.28
23 0.32
24 0.39
25 0.45
26 0.48
27 0.52
28 0.49
29 0.51
30 0.51
31 0.48
32 0.46
33 0.39
34 0.35
35 0.3
36 0.25
37 0.17
38 0.14
39 0.14
40 0.1
41 0.11
42 0.13
43 0.12
44 0.13
45 0.13
46 0.13
47 0.13
48 0.12
49 0.09
50 0.07
51 0.09
52 0.09
53 0.12
54 0.14
55 0.13
56 0.13
57 0.13
58 0.12
59 0.11
60 0.09
61 0.09
62 0.07
63 0.08
64 0.07
65 0.1
66 0.09
67 0.11
68 0.16
69 0.17
70 0.18
71 0.22
72 0.24
73 0.24
74 0.27
75 0.27
76 0.25
77 0.24
78 0.23
79 0.2
80 0.19
81 0.17
82 0.15
83 0.13
84 0.13
85 0.12
86 0.13
87 0.19
88 0.19
89 0.19
90 0.24
91 0.26
92 0.27
93 0.26
94 0.27
95 0.28
96 0.28
97 0.28
98 0.27
99 0.25
100 0.23
101 0.24
102 0.21
103 0.16
104 0.2
105 0.27
106 0.26
107 0.27
108 0.3
109 0.33
110 0.34
111 0.36
112 0.38
113 0.33
114 0.32
115 0.31
116 0.3
117 0.25
118 0.24
119 0.23
120 0.18
121 0.17
122 0.16
123 0.18
124 0.14
125 0.15
126 0.15
127 0.15
128 0.16
129 0.23
130 0.23
131 0.22
132 0.24
133 0.29
134 0.35
135 0.35
136 0.33
137 0.26
138 0.27
139 0.26
140 0.26
141 0.22
142 0.15
143 0.13
144 0.13
145 0.12
146 0.1
147 0.09
148 0.09
149 0.09
150 0.08
151 0.09
152 0.09
153 0.09
154 0.09
155 0.09
156 0.07
157 0.06
158 0.06
159 0.05
160 0.05
161 0.04
162 0.03
163 0.03
164 0.04
165 0.04
166 0.04
167 0.04
168 0.04
169 0.04
170 0.04
171 0.04
172 0.05
173 0.05
174 0.05
175 0.06
176 0.06
177 0.05
178 0.06
179 0.07
180 0.08
181 0.11
182 0.11
183 0.14
184 0.14
185 0.15
186 0.19
187 0.2
188 0.21
189 0.22
190 0.26
191 0.26
192 0.28
193 0.3
194 0.29
195 0.3
196 0.36
197 0.38
198 0.34
199 0.33
200 0.33
201 0.35
202 0.39
203 0.39
204 0.4
205 0.42
206 0.41
207 0.4
208 0.38
209 0.35
210 0.3
211 0.28
212 0.2
213 0.19
214 0.22
215 0.21
216 0.23
217 0.22
218 0.27
219 0.33
220 0.34
221 0.33
222 0.37
223 0.38
224 0.43
225 0.54
226 0.56
227 0.59
228 0.65
229 0.65
230 0.63
231 0.65
232 0.62
233 0.55
234 0.51
235 0.41
236 0.33
237 0.3
238 0.24
239 0.22
240 0.18
241 0.13
242 0.08
243 0.08
244 0.07
245 0.06
246 0.05
247 0.04
248 0.04
249 0.04
250 0.04
251 0.05
252 0.06
253 0.06
254 0.06
255 0.07
256 0.1
257 0.12
258 0.12
259 0.12
260 0.15
261 0.17
262 0.27
263 0.29
264 0.35
265 0.43
266 0.52
267 0.61
268 0.64
269 0.72
270 0.71
271 0.79
272 0.78
273 0.75
274 0.7
275 0.62
276 0.59
277 0.51
278 0.44
279 0.35
280 0.33
281 0.28
282 0.26
283 0.26
284 0.22
285 0.21
286 0.21
287 0.26
288 0.26
289 0.33
290 0.35
291 0.44
292 0.54
293 0.61
294 0.69
295 0.74
296 0.75
297 0.77
298 0.8
299 0.8
300 0.75
301 0.71
302 0.65
303 0.6
304 0.53
305 0.44
306 0.35
307 0.28
308 0.23
309 0.21
310 0.18
311 0.14
312 0.14
313 0.14
314 0.13
315 0.14
316 0.15
317 0.16
318 0.17
319 0.16
320 0.17
321 0.24
322 0.26
323 0.28
324 0.35
325 0.4
326 0.45
327 0.49
328 0.49
329 0.46
330 0.49
331 0.5
332 0.46
333 0.44
334 0.42
335 0.47
336 0.53
337 0.58
338 0.59
339 0.58
340 0.61
341 0.64
342 0.7
343 0.71
344 0.75
345 0.77
346 0.78
347 0.76
348 0.7
349 0.61
350 0.51
351 0.41
352 0.3
353 0.25
354 0.17
355 0.13
356 0.14
357 0.18
358 0.23
359 0.32
360 0.39
361 0.39
362 0.46
363 0.52
364 0.59